Phospho-VAMP4 (Ser88) Antibody - #AF7145
Product: | Phospho-VAMP4 (Ser88) Antibody |
Catalog: | AF7145 |
Description: | Rabbit polyclonal antibody to Phospho-VAMP4 (Ser88) |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 16KD; 16kD(Calculated). |
Uniprot: | O75379 |
RRID: | AB_2843585 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7145, RRID:AB_2843585.
Fold/Unfold
VAMP 24; VAMP 4; VAMP-4; VAMP24; VAMP4; VAMP4 protein; VAMP4_HUMAN; Vesicle associated membrane protein 4; Vesicle associated membrane protein 4 isoform CRA a; Vesicle associated membrane protein 4 isoform CRA b; Vesicle-associated membrane protein 4;
Immunogens
- O75379 VAMP4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75379 As Substrate
Research Backgrounds
Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule.
Golgi apparatus>trans-Golgi network membrane>Single-pass type IV membrane protein.
Note: Associated with trans Golgi network (TGN) and newly formed immature secretory granules (ISG). Not found on the mature secretory organelles.
Identified in a complex containing STX6, STX12, VAMP4 and VTI1A (By similarity). Interacts with BAIAP3; this interaction is increased in the presence of calcium.
Belongs to the synaptobrevin family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.