MMP1 Antibody - #AF0209

(7)   (8)  
Product: MMP1 Antibody
Catalog: AF0209
Description: Rabbit polyclonal antibody to MMP1
Application: WB IF/ICC
Reactivity: Human
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Mol.Wt.: 54kDa; 54kD(Calculated).
Uniprot: P03956
RRID: AB_2833396

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Prediction:
Pig(88%), Bovine(88%), Horse(100%), Sheep(94%), Rabbit(100%)
Clonality:
Polyclonal
Specificity:
MMP1 Antibody detects endogenous levels of total MMP1.
RRID:
AB_2833396
Cite Format: Affinity Biosciences Cat# AF0209, RRID:AB_2833396.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

27 kDa interstitial collagenase; CLG; CLGN; collagenase, fibroblast; collagenase, interstitial; Fibroblast collagenase; Interstitial collagenase; Matrix metallopeptidase 1 (interstitial collagenase); Matrix metalloprotease 1; Matrix Metalloproteinase 1; Matrix metalloproteinase-1; MMP 1; MMP-1; MMP1; MMP1_HUMAN; OTTHUMP00000045866;

Immunogens

Immunogen:
Uniprot:

P03956(MMP1_HUMAN) >>Visit HPA database.

Gene(ID):
MMP1(4312)
Description:
MMP1 Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
100
Horse
100
Sheep
94
Pig
88
Bovine
88
Dog
69
Chicken
53
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P03956 As Substrate

Site PTM Type Enzyme
S57 Phosphorylation
Y121 Phosphorylation
T122 Phosphorylation
S142 Phosphorylation
S153 Phosphorylation
T274 Phosphorylation
S280 Phosphorylation
T288 Phosphorylation
T289 Phosphorylation
Y360 Phosphorylation
K450 Ubiquitination

Research Backgrounds

Function:

Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.

PTMs:

Undergoes autolytic cleavage to two major forms (22 kDa and 27 kDa). A minor form (25 kDa) is the glycosylated form of the 22 kDa form. The 27 kDa form has no activity while the 22/25 kDa form can act as activator for collagenase.

Tyrosine phosphorylated in platelets by PKDCC/VLK.

Subcellular Location:

Secreted>Extracellular space>Extracellular matrix.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

(Microbial infection) Interacts with HIV-1 Tat.

Family&Domains:

There are two distinct domains in this protein; the catalytic N-terminal, and the C-terminal which is involved in substrate specificity and in binding TIMP (tissue inhibitor of metalloproteinases).

The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.

Belongs to the peptidase M10A family.

Research Fields

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Bladder cancer.   (View pathway)

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Endocrine system > PPAR signaling pathway.

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

· Organismal Systems > Endocrine system > Relaxin signaling pathway.

References

1). Parthenolide attenuated bleomycin-induced pulmonary fibrosis via the NF-κB/Snail signaling pathway. RESPIRATORY RESEARCH, 2018 (PubMed: 29871641) [IF=5.8]

Application: IHC    Species: human    Sample: lung

Fig. 6| PTL attenuates the BLM-induced expression of EMT-related protein. a Representative immunohistochemical staining of lung sections showing cadherin, vimentin, MMP1, α-SMA and Col-1 staining.
2). Timosaponin B-II alleviates osteoarthritis-related inflammation and extracellular matrix degradation through inhibition of mitogen-activated protein kinases and nuclear factor-κB pathways in vitro. Bioengineered, 2022 (PubMed: 35094658) [IF=4.9]

Application: WB    Species: Rat    Sample: SW1353 cells and chondrocytes

Figure 4. TB-II inhibited the production of cartilage degrading enzymes in IL-1β-treated SW1353 cells and chondrocytes. The mRNA expression of (a) MMP-1, (b) MMP-3 and (c) MMP-13 were detected by qRT-PCR. (d-g) The protein level of MMP-1, MMP-3, and MMP-13 were detected by Western blot. GAPDH was conducted as a loading control. One-way ANOVA, ##p < 0.01, compared with control cells; $p < 0.05, $$p < 0.01, ns: not-significant, compared with IL-1β-treated cells.
3). Identification of Active Compounds and Mechanism of Huangtu Decoction for the Treatment of Ulcerative Colitis by Network Pharmacology Combined with Experimental Verification. Drug Design Development and Therapy, 2021 (PubMed: 34616145) [IF=4.8]

Application: IHC    Species: Mice    Sample: colon tissues

Figure 9 Representative immunohistochemical staining with MMP1, MMP3, MMP7, MMP9 and MMP12 in colon tissues in mice treated with DSS. (A) Immunohistochemical staining for MMP1, MMP3, MMP7, MMP9 and MMP12 in normal, model and DSS+HTD group. (B) Statistical analysis of relative immunohistochemical staining intensity for MMP1, MMP3, MMP7, MMP9 and MMP12 in normal, model and DSS+HTD group.*P < 0.05, **P < 0.01 and ***P < 0.001 versus model group.
4). Ubiquitin-specific protease 49 attenuates IL-1β-induced rat primary chondrocyte apoptosis by facilitating Axin deubiquitination and subsequent Wnt/β-catenin signaling cascade inhibition. MOLECULAR AND CELLULAR BIOCHEMISTRY, 2020 (PubMed: 32737772) [IF=4.3]

Application: WB    Species: rat    Sample: chondrocytes

FIGURE 2 |e) Western blot analysis (right panel) and band intensity analysis (left panel) of the protein levels of Survivin, Mmp1, and Mmp13 in Control+Vehicle, Vector+IL-1β, and oeUSP49 +IL-1β rat chondro-cytes. ***P<0.001 versus the Vector or Control+Vehicle group; ## and ### indicate P values less than 0.01 and 0.001,respectively, versus the Vec-tor+IL-1β group
5). Pathological changes and expression of lysine oxidases and matrix metalloproteinases‐1,‐2, and‐3 in ligaments of patients with haemophilic arthritis. HAEMOPHILIA, 2022 (PubMed: 34697874) [IF=3.9]

Application: WB    Species: human    Sample: cruciate ligaments

Figure 5.|LOXs and MMP-1,-2,and -3protein expression levels in the cruciate ligaments of patients with OA or HA
6). Circ-Sirt1 inhibits proliferation, induces apoptosis, and ameliorates inflammation in human rheumatoid arthritis fibroblast-like synoviocytes. AUTOIMMUNITY, 2021 (PubMed: 34431434) [IF=3.5]
7). Forsythiaside A Regulates Activation of Hepatic Stellate Cells by Inhibiting NOX4-Dependent ROS. Oxidative Medicine and Cellular Longevity, 2022 (PubMed: 35035671)

Application: WB    Species: Rat    Sample: HSCs

Figure 4 FA promoted collagen metabolism. (A-B) The expression of MMP-1 and TIMP-1 mRNA. (C-D) The expression of MMP-1 and TIMP-1 proteins. (E-G) The content of MMP-1 and TIMP-1 in medium supernatant. (H) The content of hydroxyproline. Data of three independent experiments were represented by mean ± S.D. ∗∗∗p <0.001 TGF-β1 vs control; ∗∗p <0.01 TGF-β1 vs control. ###p <0.001 TGF-β1 + FA vs TGF-β1;##p <0.01 TGF-β1 + FA vs TGF-β1; #p <0.05 TGF-β1 + FA vs TGF-β1.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.