SYT Antibody - #AF9206
| Product: | SYT Antibody |
| Catalog: | AF9206 |
| Description: | Rabbit polyclonal antibody to SYT |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Bovine, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 45kDa; 46kD(Calculated). |
| Uniprot: | Q15532 |
| RRID: | AB_2843396 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9206, RRID:AB_2843396.
Fold/Unfold
MGC116875; Protein SSXT; Protein SYT; SS18; SSXT; SSXT/SSX4v fusion; SSXT_HUMAN; Synovial sarcoma translocated to X chromosome; Synovial sarcoma translocated to X chromosome protein; Synovial sarcoma translocation chromosome 18; SYT; SYT SSX1; SYT SSX2; SYT/SSX4v fusion protein; SYTSSX1; SYTSSX2;
Immunogens
Fairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas.
- Q15532 SSXT_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15532 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Acetylation | Uniprot | |
| R9 | Methylation | Uniprot | |
| K13 | Ubiquitination | Uniprot | |
| T17 | Phosphorylation | Uniprot | |
| K41 | Ubiquitination | Uniprot | |
| Y416 | Phosphorylation | Uniprot |
Research Backgrounds
Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation. Component of SWI/SNF chromatin remodeling subcomplex GBAF that carries out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner.
Nucleus.
Fairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas.
Interacts with MLLT10. Isoform 1 interacts with RBM14 isoform 1. Isoform 2 interacts with RBM14 isoform 1. Component of the multiprotein chromatin-remodeling complexes SWI/SNF: SWI/SNF-A (BAF), SWI/SNF-B (PBAF) and related complexes. The canonical complex contains a catalytic subunit (either SMARCA4/BRG1/BAF190A or SMARCA2/BRM/BAF190B) and at least SMARCE1, ACTL6A/BAF53, SMARCC1/BAF155, SMARCC2/BAF170, and SMARCB1/SNF5/BAF47. Other subunits specific to each of the complexes may also be present permitting several possible combinations developmentally and tissue specific. Component of the SWI/SNF (GBAF) subcomplex, which includes at least BICRA or BICRAL (mutually exclusive), BRD9, SS18, the core BAF subunits, SMARCA2/BRM, SMARCA4/BRG1/BAF190A, ACTL6A/BAF53, SMARCC1/BAF155, and SMARCD1/BAF60A.
Belongs to the SS18 family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.