Septin 1 Antibody - #AF9196
Product: | Septin 1 Antibody |
Catalog: | AF9196 |
Description: | Rabbit polyclonal antibody to Septin 1 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 41kDa; 42kD(Calculated). |
Uniprot: | Q8WYJ6 |
RRID: | AB_2843386 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9196, RRID:AB_2843386.
Fold/Unfold
DIFF6; Differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase); LARP; MGC20394; Peanut like protein 3; Peanut-like protein 3; PNUTL3; SEP1; SEPT1; SEPT1_HUMAN; Septin 1; Septin-1; Serologically defined breast cancer antigen NY BR 24; Serologically defined breast cancer antigen NY-BR-24;
Immunogens
- Q8WYJ6 SEPT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WYJ6 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K3 | Ubiquitination | Uniprot | |
Y5 | Phosphorylation | Uniprot | |
K18 | Ubiquitination | Uniprot | |
S19 | Phosphorylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
T48 | Phosphorylation | Uniprot | |
Y51 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
K84 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
S132 | Phosphorylation | Uniprot | |
K162 | Ubiquitination | Uniprot | |
K171 | Ubiquitination | Uniprot | |
K184 | Ubiquitination | Uniprot | |
K186 | Ubiquitination | Uniprot | |
Y199 | Phosphorylation | Uniprot | |
S206 | Phosphorylation | Uniprot | |
K213 | Ubiquitination | Uniprot | |
K220 | Ubiquitination | Uniprot | |
R240 | Methylation | Uniprot | |
Y247 | Phosphorylation | Uniprot | |
S248 | Phosphorylation | Q96GD4 (AURKB) | Uniprot |
T251 | Phosphorylation | Uniprot | |
K278 | Ubiquitination | Uniprot | |
Y286 | Phosphorylation | Uniprot | |
Y289 | Phosphorylation | Uniprot | |
S307 | Phosphorylation | Q96GD4 (AURKB) | Uniprot |
S315 | Phosphorylation | Q96GD4 (AURKB) | Uniprot |
T317 | Phosphorylation | Uniprot | |
K331 | Ubiquitination | Uniprot | |
K336 | Ubiquitination | Uniprot | |
K349 | Ubiquitination | Uniprot |
Research Backgrounds
Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).
Cytoplasm. Cytoplasm>Cytoskeleton. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Midbody.
Note: Remains at the centrosomes and the nearby microtubules throughout mitosis. Localizes to the midbody during cytokinesis.
Expressed at high levels in lymphoid and hematopoietic tissues.
Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation (By similarity). Interacts with AURKB.
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.