Rho G Antibody - #AF9182
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9182, RRID:AB_2843372.
Fold/Unfold
ARHG; Ras homolog family member G; Rho G; Rho related GTP binding protein RhoG precursor; Rho-related GTP-binding protein RhoG; RHOG; RHOG_HUMAN;
Immunogens
- P84095 RHOG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P84095 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y32 | Phosphorylation | Uniprot | |
| Y64 | Phosphorylation | Uniprot | |
| K116 | Ubiquitination | Uniprot | |
| T125 | Phosphorylation | Uniprot | |
| K130 | Ubiquitination | Uniprot | |
| T138 | Phosphorylation | Uniprot | |
| K147 | Ubiquitination | Uniprot | |
| C157 | S-Nitrosylation | Uniprot | |
| K166 | Ubiquitination | Uniprot | |
| T180 | Phosphorylation | Uniprot | |
| K183 | Ubiquitination | Uniprot |
Research Backgrounds
Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Interacts with ARHGEF26. Interacts with ARHGEF16.
Belongs to the small GTPase superfamily. Rho family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
· Human Diseases > Infectious diseases: Bacterial > Shigellosis.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.