Dynein IC1 Antibody - #AF9056
Product: | Dynein IC1 Antibody |
Catalog: | AF9056 |
Description: | Rabbit polyclonal antibody to Dynein IC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 79kDa; 79kD(Calculated). |
Uniprot: | Q9UI46 |
RRID: | AB_2843247 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9056, RRID:AB_2843247.
Fold/Unfold
Axonemal dynein intermediate chain 1; Axonemal dynein intermediate chain 2; CILD 1; CILD1; Cytoplasmic dynein 1 intermediate chain 1; Cytoplasmic dynein 1 intermediate chain 2; Cytoplasmic dynein intermediate chain 1; Cytoplasmic dynein intermediate chain 2; DH IC 1; DH IC 2; DIC1; DNAI 1; DNAI 2; DNAI1; DNAI1_HUMAN; DNAI2; DNCI 2; DNCI1; DNCI2; DNCIC 1; DNCIC 2; DNCIC1; DNCIC2; DYNC1I1; DYNC1I2; Dynein axonemal intermediate chain 1; Dynein axonemal intermediate polypeptide 1; Dynein axonemal intermediate polypeptide 2; Dynein cytoplasmic intermediate polypeptide 1; Dynein cytoplasmic intermediate polypeptide 2; Dynein intermediate chain 1 axonemal; Dynein intermediate chain 1 cytosolic; Dynein intermediate chain 1, axonemal; Dynein intermediate chain 2 axonemal; Dynein intermediate chain 2 cytosolic; Dynein intermediate chain DNAI1; IC74; ICS; ICS1; Immotile cilia syndrome 1; MGC26204; PCD;
Immunogens
- Q9UI46 DNAI1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIPASAKAPHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQVGNLIPKDSDEGRRQHYRDELVAGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEELMTPKQPKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIYDAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVNQNTYDDIAQDFKYYDDAADEYRDQVGTLLPLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFMKQSRGMLLLYSLKNPSFPEYMFSSNSGVMCLDIHVDHPYLVAVGHYDGNVAIYNLKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFSVSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSKSYSSQFLDTYDAHNMSVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIKTPMFIYDLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAKKNRLTHVQFNLIHPIIIVGDDRGHIISLKLSPNLRKMPKEKKGQEVQKGPAVEIAKLDKLLNLVREVKIKT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UI46 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T71 | Phosphorylation | Uniprot | |
S131 | Phosphorylation | Uniprot | |
S134 | Phosphorylation | Uniprot | |
T179 | Phosphorylation | Uniprot | |
Y295 | Phosphorylation | Uniprot | |
Y304 | Phosphorylation | Uniprot | |
Y312 | Phosphorylation | Uniprot |
Research Backgrounds
Part of the dynein complex of respiratory cilia.
Cytoplasm>Cytoskeleton>Cilium axoneme. Cell projection>Cilium.
Consists of at least two heavy chains and a number of intermediate and light chains. Interacts with BICD2.
Belongs to the dynein intermediate chain family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.