CNOT2 Antibody - #AF9043
Product: | CNOT2 Antibody |
Catalog: | AF9043 |
Description: | Rabbit polyclonal antibody to CNOT2 |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 46kDa; 60kD(Calculated). |
Uniprot: | Q9NZN8 |
RRID: | AB_2843234 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9043, RRID:AB_2843234.
Fold/Unfold
CCR4 associated factor 2; CCR4 NOT transcription complex subunit 2; CCR4-associated factor 2; CCR4-NOT transcription complex subunit 2; CDC36; CNOT2; CNOT2_HUMAN; HSPC131; MSTP046; Negative regulator of transcription 2; NOT2 (negative regulator of transcription 2 yeast) homolog; NOT2; NOT2H;
Immunogens
Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
- Q9NZN8 CNOT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NZN8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K12 | Ubiquitination | Uniprot | |
S35 | Phosphorylation | Uniprot | |
Y37 | Phosphorylation | Uniprot | |
Y43 | Phosphorylation | Uniprot | |
Y44 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S47 | Phosphorylation | Uniprot | |
S48 | Phosphorylation | Uniprot | |
K56 | Acetylation | Uniprot | |
S61 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S65 | Phosphorylation | Uniprot | |
S69 | Phosphorylation | Uniprot | |
R87 | Methylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
T93 | Phosphorylation | Uniprot | |
S99 | Phosphorylation | Uniprot | |
S101 | Phosphorylation | Q13535 (ATR) | Uniprot |
T104 | Phosphorylation | Uniprot | |
S108 | Phosphorylation | Uniprot | |
T111 | Phosphorylation | Uniprot | |
T113 | Phosphorylation | Uniprot | |
T114 | Phosphorylation | Uniprot | |
T118 | Phosphorylation | Uniprot | |
S120 | Phosphorylation | Uniprot | |
T123 | Phosphorylation | Uniprot | |
S126 | Phosphorylation | Uniprot | |
S128 | Phosphorylation | Uniprot | |
R137 | Methylation | Uniprot | |
S143 | Phosphorylation | Uniprot | |
T155 | Phosphorylation | Uniprot | |
S157 | Phosphorylation | Uniprot | |
S159 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
S161 | Phosphorylation | Uniprot | |
S165 | Phosphorylation | Uniprot | |
S169 | Phosphorylation | Uniprot | |
S170 | Phosphorylation | Uniprot | |
S242 | Phosphorylation | Uniprot | |
T246 | Phosphorylation | Uniprot | |
Y258 | Phosphorylation | Uniprot | |
S274 | Phosphorylation | Uniprot | |
S293 | Phosphorylation | Uniprot | |
S294 | Phosphorylation | Uniprot | |
K299 | Acetylation | Uniprot | |
T304 | Phosphorylation | Uniprot | |
S305 | Phosphorylation | Uniprot | |
K307 | Ubiquitination | Uniprot | |
T308 | Phosphorylation | Uniprot | |
K321 | Ubiquitination | Uniprot | |
S391 | Phosphorylation | Uniprot | |
Y396 | Phosphorylation | Uniprot | |
Y471 | Phosphorylation | Uniprot | |
T480 | Phosphorylation | Uniprot | |
K490 | Ubiquitination | Uniprot | |
Y494 | Phosphorylation | Uniprot | |
Y500 | Phosphorylation | Uniprot | |
K512 | Ubiquitination | Uniprot | |
K520 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for the CCR4-NOT complex structural integrity. Can repress transcription and may link the CCR4-NOT complex to transcriptional regulation; the repressive function may specifically involve the N-Cor repressor complex containing HDAC3, NCOR1 and NCOR2. Involved in the maintenance of embryonic stem (ES) cell identity.
Cytoplasm. Nucleus.
Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits. In the complex interacts directly with CNOT3. Interacts with NCOR1, NCOR2. HDAC3 and GPS2.
Belongs to the CNOT2/3/5 family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.