ASF1B Antibody - #AF9022
Product: | ASF1B Antibody |
Catalog: | AF9022 |
Description: | Rabbit polyclonal antibody to ASF1B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Sheep, Rabbit, Xenopus |
Mol.Wt.: | 26kDa; 22kD(Calculated). |
Uniprot: | Q9NVP2 |
RRID: | AB_2843213 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9022, RRID:AB_2843213.
Fold/Unfold
Anti silencing function 1B; Anti silencing function 1B histone chaperone; Anti-silencing function protein 1 homolog B; ASF1 anti silencing function 1 homolog B (S. cerevisiae); ASF1 anti silencing function 1 homolog B; ASF1B; ASF1B_HUMAN; CCG1 interacting factor A II; CCG1-interacting factor A-II; CIA-II; hAsf1; hAsf1b; hCIA-II; Histone chaperone ASF1B;
Immunogens
Highly expressed in testis and at lower levels in colon, small intestine and thymus.
- Q9NVP2 ASF1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NVP2 As Substrate
Research Backgrounds
Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis.
Phosphorylated by TLK1 and TLK2.
Nucleus.
Highly expressed in testis and at lower levels in colon, small intestine and thymus.
Interacts with histone H3 (including both histone H3.1 and H3.3) and histone H4. Interacts with the CHAF1A, CHAF1B and RBBP4 subunits of the CAF-1 complex. Interacts with HAT1, NASP, TAF1, TLK1 and TLK2. Interacts with CDAN1. Found in a cytosolic complex with CDAN1, ASF1A, IPO4 and histones H3.1 and H4. Interacts with CREBBP.
Belongs to the ASF1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.