FXYD2 Antibody - #DF9941
Product: | FXYD2 Antibody |
Catalog: | DF9941 |
Description: | Rabbit polyclonal antibody to FXYD2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Chicken |
Mol.Wt.: | 7 kDa; 7kD(Calculated). |
Uniprot: | P54710 |
RRID: | AB_2843135 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9941, RRID:AB_2843135.
Fold/Unfold
Sodium potassium ATPase, gamma-1 polypeptide; ATP 1C; ATP1 C; ATP1 G1; ATP1C; ATP1G 1; ATP1G1; ATPase, Na+/K+ transporting, gamma 1 polypeptide; FXYD 2; FXYD domain containing ion transport regulator 2; Gamma subunit of sodium potassium ATPase; GNAKATP; HOMG 2; HOMG2; Hypomagnesemia 2, renal; Na(+)/K(+) ATPase subunit gamma; Sodium potassium ATPase, gamma polypeptide; Sodium pump gamma chain; Sodium/potassium-transporting ATPase gamma chain; sodium/potassium-transporting ATPase subunit gamma;
Immunogens
Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.
- P54710 ATNG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P54710 As Substrate
Site | PTM Type | Enzyme | Source |
---|
Research Backgrounds
May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.
Membrane>Single-pass type III membrane protein.
Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.
Regulatory subunit of the sodium/potassium-transporting ATPase which is composed of a catalytic alpha subunit, an auxiliary non-catalytic beta subunit and an additional regulatory subunit.
Belongs to the FXYD family.
Research Fields
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Organismal Systems > Circulatory system > Cardiac muscle contraction. (View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes. (View pathway)
· Organismal Systems > Endocrine system > Insulin secretion. (View pathway)
· Organismal Systems > Endocrine system > Thyroid hormone synthesis.
· Organismal Systems > Endocrine system > Thyroid hormone signaling pathway. (View pathway)
· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.
· Organismal Systems > Excretory system > Endocrine and other factor-regulated calcium reabsorption.
· Organismal Systems > Excretory system > Proximal tubule bicarbonate reclamation.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Carbohydrate digestion and absorption.
· Organismal Systems > Digestive system > Protein digestion and absorption.
· Organismal Systems > Digestive system > Mineral absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.