SCNM1 Antibody - #DF9928
| Product: | SCNM1 Antibody |
| Catalog: | DF9928 |
| Description: | Rabbit polyclonal antibody to SCNM1 |
| Application: | WB IHC |
| Reactivity: | Human, Rat, Monkey |
| Prediction: | Bovine, Horse, Sheep |
| Mol.Wt.: | 26 kDa; 26kD(Calculated). |
| Uniprot: | Q9BWG6 |
| RRID: | AB_2843122 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9928, RRID:AB_2843122.
Fold/Unfold
SCNM 1; Sodium channel modifier 1;
Immunogens
- Q9BWG6 SCNM1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BWG6 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S2 | Phosphorylation | Uniprot | |
| K17 | Ubiquitination | Uniprot | |
| Y76 | Phosphorylation | Uniprot | |
| K101 | Ubiquitination | Uniprot | |
| S126 | Phosphorylation | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| S159 | Phosphorylation | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| Y193 | Phosphorylation | Uniprot | |
| T195 | Phosphorylation | Uniprot | |
| S219 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in alternative splicing of pre-mRNAs, possibly by contributing to the selection of non-consensus donor sites.
Nucleus>Nucleoplasm. Nucleus speckle.
Note: Colocalizes with LUC7L2 and SNRNP70 in nuclear speckles.
Interacts with spliceosomal Sm proteins. Interacts with LUC7L2 and SNRNP70, which suggests a role as a spliceosome component (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.