Product: CXCL9 Antibody
Catalog: DF9920
Description: Rabbit polyclonal antibody to CXCL9
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human
Mol.Wt.: 10 kDa(Observed); 14kD(Calculated).
Uniprot: Q07325
RRID: AB_2843114

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CXCL9 Antibody detects endogenous levels of total CXCL9.
RRID:
AB_2843114
Cite Format: Affinity Biosciences Cat# DF9920, RRID:AB_2843114.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-X-C motif chemokine 9; chemokine (C-X-C motif) ligand 9; CMK; crg-10; CXCL9; CXCL9_HUMAN; gamma interferon induced monokine; Gamma-interferon-induced monokine; HuMIG; MIG; monokine induced by gamma interferon; monokine induced by interferon gamma; Monokine induced by interferon-gamma; SCYB9; Small inducible cytokine B9; small inducible cytokine subfamily B member 9; Small-inducible cytokine B9;

Immunogens

Immunogen:

A synthesized peptide derived from human CXCL9, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

Research Backgrounds

Function:

Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

References

1). RNF8 enhances the sensitivity of PD-L1 inhibitor against melanoma through ubiquitination of galectin-3 in stroma. Cell death discovery, 2023 (PubMed: 37391451) [IF=7.0]

Application: WB    Species: Mouse    Sample:

Fig. 7: Inhibition of gal-3 enhanced sensitivity of PD-L1 therapy for melanoma. PD-L1 inhibitor was dosed by intraperitoneal injection at 1 μmol per mouse. LAC was dosed by intratumor injection at a single dose of 0.1 μmol per mouse. A The 3D modeling of subcutaneous tumor-beared in RNF8+/+ host that was treated with different strategies, including PD-L1 inhibitor, LAC, and PD-L1 inhibitor plus LAC (P + L). B The representative tumors in each group were shown. C The tumor volume (left) and the ratio of tumor weight (right). D Tumor growth volume in different groups. E The Ki-67 immunohistochemical staining of tumors. F Statistical analysis of Ki-67 in (E). G HE staining of melanomas in different groups. The arrow points to lymphocytes. H The ratio of tumor area compared to stroma area in each group (left). The number of lymphocytes in groups (right). I The western blot of IL-12, IFN-γ, CXCL-9, and CXCL-10 in PD-L1 inhibitor, LacNAc, and combination group. All values are presented as the mean ± SD (n = 6).

2). Establishment and validation of a novel invasion-related gene signature for predicting the prognosis of ovarian cancer. Cancer Cell International, 2022 (PubMed: 35292033) [IF=5.8]

Application: IHC    Species: Human    Sample: OC tissues

Fig. 6 The qPCR (A) and IHC (B) results showed that FOXJ1, MXRA5 and CXCL9 expression was low and that KIF26B, VSIG4 and COL6A6 expression was high in OC tissues

3). Prognostic and therapeutic insights from lactate metabolism and tumor immune microenvironment in head and neck squamous cell carcinoma. Discover oncology, 2025 (PubMed: 40411665) [IF=2.2]

Application: IHC    Species: human    Sample:

Fig. 5 Immunohistochemical expression of chemokines CXCL9 and CXCL10 in tumor tissues across different clinical stages. A CXCL9 and B CXCL10 expression progressively decrease with advancing tumor stage. Data are presented as mean ± SD based on integrated optical density (IOD) measurements. **: P < 0.01

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.