Product: CXCL5 Antibody
Catalog: DF9919
Description: Rabbit polyclonal antibody to CXCL5
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Rabbit
Mol.Wt.: 12 kDa(Observed); 12kD(Calculated).
Uniprot: P42830
RRID: AB_2843113

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Rabbit(83%)
Clonality:
Polyclonal
Specificity:
CXCL5 Antibody detects endogenous levels of total CXCL5.
RRID:
AB_2843113
Cite Format: Affinity Biosciences Cat# DF9919, RRID:AB_2843113.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AMCFII; C-X-C motif chemokine 5; C-X-C motif chemokine ligand 5; chemokine (C-X-C motif) ligand 5; Cxcl5; CXCL5_HUMAN; ENA 78; ENA-78 (8-78); ENA-78(1-78); ENA-78(9-78); ENA78; Epithelial derived neutrophil activating protein 78; Epithelial-derived neutrophil-activating protein 78; Lipopolysaccharide-induced CXC chemokine; Neutrophil activating peptide ENA 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5; Small inducible cytokine B5; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); small inducible cytokine subfamily B, member 5; Small-inducible cytokine B5;

Immunogens

Immunogen:

A synthesized peptide derived from human CXCL5, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
83
Pig
0
Horse
0
Bovine
0
Sheep
0
Dog
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.

PTMs:

N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). Taraxasterol regulates p53 transcriptional activity to inhibit pancreatic cancer by inducing MDM2 ubiquitination degradation. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 39671783) [IF=7.9]

Application: WB    Species: human    Sample: BxPC-3 and PATU 8988t cells

Fig 7. TAX inhibits cell proliferation by regulating CXCL5 transcription in PC. (A, B) The expression level of CXCL5 mRNA and protein was detected by qRT-PCR and western blot assay. (C, D) The cell viability was detected in BxPC-3 and PATU 8988t cells after treatment with TAX or/and CXCL5 overexpression by MTT and colony formation assays. (E-G) The effect of CXCL5 overexpression on cell cycle distribution and apoptosis in TAX treated and untreated BxPC-3 and PATU 8988t cells was detected by flow cytometry and western blot analysis. (H) The transfected effects of siRNA of p53 were detected by western blot analysis. (I) The effects of TAX or/and p53 knockdown on CXCL5 mRNA levels were detected by qRT-PCR. Data were shown as mean ± SD, n = 3. * p < 0.05, ** p < 0.01, *** p < 0.001.

2). Concomitant NAFLD Facilitates Liver Metastases and PD-1-Refractory by Recruiting MDSCs via CXCL5/CXCR2 in Colorectal Cancer. Cellular and molecular gastroenterology and hepatology, 2024 (PubMed: 38724007) [IF=7.1]

Application: IF/ICC    Species: Mouse    Sample:

Figure 6. NAFLD promotes CXCL5 and recruits CXCR2+ MDSCs accumulation in liver metastases. (A) Mouse XL Cytokine Array detects multiple cytokines, chemokines, growth factors, and other soluble proteins in serum. Data shown are from a 5-minute exposure to Bio-Rad, top: CRLM group, bottom: NAFLD with CRLM group. (B) Relative cytokine levels in serum of each tumor-bearing C57BL/6 mice models. (C) Localization of CXCL5 and CXCR2 reactivity in tissue samples of ob/ob and WT group, acquired by confocal imaging. Scale bars represent 100 μm, upper panel; 20 μm, lower panel.

3). CXCL5 Downregulation in Villous Tissue Is Correlated With Recurrent Spontaneous Abortion. Frontiers in Immunology, 2021 (PubMed: 34603292) [IF=5.7]

Application: IHC    Species: Human    Sample: placental villous tissue

Figure 1 CXCL5 expression in human placental villous tissue from the RSA group and the control group. (A) Expression of CXCL5 mRNA in the RSA group (n = 15) and control group (n = 13) by RT-PCR. (B, C) Representative immunohistochemical staining images and quantification of CXCL5 in the RSA group (n = 15) and normal group (n = 13). Relative gene expression was normalized to GAPDH. ImageJ is used to quantify the staining intensity. Magnification, ×200 and ×400. Scale bars = 100 μm. Data are presented as the mean ± SD. Results are reported as fold change compared with the control group. (*p < 0.05, **p < 0.01). RSA, recurrent spontaneous abortion; mRNA, messenger RNA; RT‐PCR, quantitative real-time polymerase chain reaction; CXCL5, C-X-C motif chemokine ligand 5; IHC, immunohistochemistry.

Application: IHC    Species: Human    Sample: placental villous tissue

Figure 1 CXCL5 expression in human placental villous tissue from the RSA group and the control group. (A) Expression of CXCL5 mRNA in the RSA group (n = 15) and control group (n = 13) by RT-PCR. (B, C) Representative immunohistochemical staining images and quantification of CXCL5 in the RSA group (n = 15) and normal group (n = 13). Relative gene expression was normalized to GAPDH. ImageJ is used to quantify the staining intensity. Magnification, ×200 and ×400. Scale bars = 100 μm. Data are presented as the mean ± SD. Results are reported as fold change compared with the control group. (*p < 0.05, **p < 0.01). RSA, recurrent spontaneous abortion; mRNA, messenger RNA; RT‐PCR, quantitative real-time polymerase chain reaction; CXCL5, C-X-C motif chemokine ligand 5; IHC, immunohistochemistry.

4). Transcriptomics Reveals Effect of Pulsatilla Decoction Butanol Extract in Alleviating Vulvovaginal Candidiasis by Inhibiting Neutrophil Chemotaxis and Activation via TLR4 Signaling. Pharmaceuticals (Basel, Switzerland), 2024 (PubMed: 38794163) [IF=4.6]

Application: WB    Species: Mouse    Sample:

Figure 13. BEPD downregulated the expression of chemokine-associated proteins (Western blots). Western blots were utilized to detect the expression of CXCL1, CXCL3, S100A8, and S100A9 proteins. Values are presented as mean ± SD. n = 3. ** p < 0.01, vs. control group; *** p < 0.01, vs. control group; # p < 0.05, vs. model group; ## p < 0.01, vs. model group; ### p < 0.001, vs. model group. BEPD, n-butanol extract of Pulsatilla decoction; BEPD-L, low-dose BEPD group (20 mL/kg); BEPD-M, medium-dose BEPD group (40 mL/kg); BEPD-H, high-dose BEPD group (80 mL/kg); Flu, fluconazole group.

5). MiR-597-5p inhibits carcinogenesis and macrophage recruitment in colitis-related colorectal cancer via reducing the expression of CXCL5. Cancer biology & therapy, 2023 (PubMed: 37942533) [IF=4.4]

Application: IHC    Species: Mouse    Sample:

Figure 4. CXCL5 antibody attenuates mucosal injury and slows down the development of neoplasia in AOM/DSS-treated miR-597-5pIEC/- mice. (a) the colon length ofmice was gauged. N = 3. (b) the number of tumors was calculated after 18 weeks of AOM/DSS exposure. N = 6. (c-d) histological colitis scores of mice andrepresentative images of histological sections in each group. N = 3. *P < .05, **P < .01, ***P < .001.6 S. LI ET AL.

6). Integrative analysis reveals chemokines CCL2 and CXCL5 mediated shear stress-induced aortic dissection formation. Heliyon, 2023 (PubMed: 38163105) [IF=4.0]

Application: WB    Species: human    Sample:

Fig. 6 Chemokine receptor and ligand profiles in pulsatile shear stress-induced HAEC and AD. (A–C) Trends of chemokine receptors and ligands change over time in shear stress-induced HAEC. (D–F) Significantly differently expressed chemokine receptors and ligands in three AD datasets. (G, H) Immunoblotting validation of chemokines CCL2 and CXCL5 is significantly differently expressed in the three AD datasets. (I, J) Quantitative data of relative protein level to β-actin. At least three experiments were repeated, and the representative figures are shown. *P < 0.05, ***P < 0.001 compared with the control group. Before statistical comparisons, normality and equal variance were first tested. After checking for similar variance among normally distributed data, differences between the two groups were analyzed by Student's t-test.

7). TSZAF monomer combination downregulates the Wnt/β-catenin signaling pathway and inhibits neutrophil recruitment to prevent lung cancer metastasis. Chinese Journal of Natural Medicines, 2025 [IF=4.0]

Application: WB    Species: Mouse    Sample: lung cancer cells

Figure 7. TSZAF mc decreased the secretion of CXCL5 from tumor cells to reduce neutrophils infiltration. (A) CTC-TJH-01 cells was treated with TSZAF mc (0, 0.5, 1 μM) for 24 h, the relative mRNA expression levels of CXCL1, CXCL5 and IL-8 was analyzed by RT-PCR. (B) The CTC-TJH-01 and LLC cells were exposed to TSZAF mc (0, 0.5, 1 μM) for 24 h, the protein expression of CXCL1, CXCL5 and IL-8 were detected by WB. β-actin was used as an internal standard. (C) The proportion of neutrophils recruited by LLC cells in vitro was detected by flow cytometry. (D) The IF staining results of Ly6G expression in lung metastases. Scale bar 50 μm. (E) The immunohistochemistry staining results of CXCL5 expression in lung metastases. Scale bar 40 μm. n=8, *P < 0.05, **P < 0.01, ***P < 0.001 compared with the control group.

Application: IHC    Species: Mouse    Sample: lung cancer cells

Figure 7. TSZAF mc decreased the secretion of CXCL5 from tumor cells to reduce neutrophils infiltration. (A) CTC-TJH-01 cells was treated with TSZAF mc (0, 0.5, 1 μM) for 24 h, the relative mRNA expression levels of CXCL1, CXCL5 and IL-8 was analyzed by RT-PCR. (B) The CTC-TJH-01 and LLC cells were exposed to TSZAF mc (0, 0.5, 1 μM) for 24 h, the protein expression of CXCL1, CXCL5 and IL-8 were detected by WB. β-actin was used as an internal standard. (C) The proportion of neutrophils recruited by LLC cells in vitro was detected by flow cytometry. (D) The IF staining results of Ly6G expression in lung metastases. Scale bar 50 μm. (E) The immunohistochemistry staining results of CXCL5 expression in lung metastases. Scale bar 40 μm. n=8, *P < 0.05, **P < 0.01, ***P < 0.001 compared with the control group.

8). LncRNA NEAT1: A novel regulator associated with the inflammatory response in acute respiratory distress syndrome. Gene, 2023 (PubMed: 37353041) [IF=2.6]

Application: WB    Species: human    Sample: A549 cells

Fig. 8. NEAT1 is involved in the inflammatory response in lung epithelial cells. (a) Wound scratch assay was performed and the changes of scratches were recorded at 0 h and 24 h. (b) Measurement and calculation of the migration rates were performed by image J. (c) Western blot was used to detect the expression of protein MMP9 and CXCL5 in A549 cells with NEAT1 suppression. (d-g) qPCR was utilized to analyze the expression of pro-inflammatory factors and miR-21-5p in A549 cells after LPS stimulation and NEAT1 knockdown. (h) Western blot was conducted to identify the expression of protein MMP9 and CXCL5 in A549 cells after LPS stimulation and NEAT1 knockdown. (i) The production of ROS was assessed by DCFH-DA probe. Representative white light images (upper) and fluorescence images (lower) were shown. (j-l) qPCR was utilized to analyze the expression of pro-inflammatory factors in A549 cells after miR-21-5p inhibition. Scale bar = 100 μm. Data were described with mean ± standard, n = 3. *p < 0.05 vs. the control group. **p < 0.01 vs. the control group. #p < 0.05 vs. the LPS group. ##p < 0.01 vs. the LPS group.

9). Upregulation of ITGB6 in primary palmar hyperhidrosis. Advances in clinical and experimental medicine : official organ Wroclaw Medical University, 2023 (PubMed: 37212774) [IF=2.1]

Application: WB    Species: Human    Sample:

Fig. 6. Regulatory effects of integrin β6 (ITGB6) on CXCL3, CXCL5, CXCL10, CXCL11, and WNT2 expression levels in sweat gland cells. Sweat gland cells extracted from patients with primary palmar hyperhidrosis were treated with blank control or transfected with overexpression negative control (OE NC) or ITGB6 OE. The CXCL3, CXCL5, CXCL10, CXCL11, and WNT2 (A) mRNA (ITGB6 OE compared to control, Tukey’s honest significant difference (HSD), p < 0.001, all), and (B,C) protein expression (ITGB6 OE compared to control, CXCL3, CXCL5, and CXCL11: Tukey’s HSD, all p < 0.001; CXCL10: Tukey’s HSD, p = 0.004; WNT2: Tukey’s HSD, p = 0.027). The data are presented as mean ± 95% confidence interval (95% CI)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.