CXCL13 Antibody - #DF9918
![](/images/pubmed.gif)
Product: | CXCL13 Antibody |
Catalog: | DF9918 |
Description: | Rabbit polyclonal antibody to CXCL13 |
Application: | WB |
Reactivity: | Human, Monkey |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog |
Mol.Wt.: | 13 kDa; 13kD(Calculated). |
Uniprot: | O43927 |
RRID: | AB_2843112 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9918, RRID:AB_2843112.
Fold/Unfold
ANGIE; ANGIE2; B cell attracting chemokine 1; B cell-attracting chemokine 1; B lymphocyte chemoattractant; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BCA-1; BLC; BLR1L; C-X-C motif chemokine 13; Chemokine (C-X-C motif) ligand 13; Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); Chemokine, CXC motif, ligand 13; CXC chemokine BLC; CXCL13; CXL13_HUMAN; SCYB13; Small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); Small inducible cytokine B13; Small inducible cytokine subfamily B, member 13; Small-inducible cytokine B13;
Immunogens
Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
- O43927 CXL13_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O43927 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S39 | Phosphorylation | Uniprot | |
S40 | Phosphorylation | Uniprot | |
K63 | Sumoylation | Uniprot | |
K69 | Ubiquitination | Uniprot |
Research Backgrounds
Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Secreted.
Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
Belongs to the intercrine alpha (chemokine CxC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
References
Application: WB Species: mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.