CCL16 Antibody - #DF9912
Product: | CCL16 Antibody |
Catalog: | DF9912 |
Description: | Rabbit polyclonal antibody to CCL16 |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | O15467 |
RRID: | AB_2843106 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9912, RRID:AB_2843106.
Fold/Unfold
C-C motif chemokine 16; CCL16; CCL16_HUMAN; Chemokine (C-C motif) ligand 16; Chemokine CC-4; Chemokine LEC; CKb12; HCC-4; HCC4; IL-10-inducible chemokine; IL10 inducible chemokine; IL10 inducible chemokine; ILINCK; LCC-1; LCC1; Liver CC chemokine 1 precursor; Liver expressed chemokine; Liver-expressed chemokine; LMC; Lymphocyte and monocyte chemoattractant; Monotactin 1; Monotactin-1; MTN-1; Mtn1; NCC-4; NCC4; New CC chemokine 4; SCYA16; SCYL4; Small inducible cytokine A16 precursor; Small inducible cytokine A16 precursor; Small inducible cytokine subfamily A (Cys Cys) member 16; Small-inducible cytokine A16;
Immunogens
Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
- O15467 CCL16_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Research Backgrounds
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
Secreted.
Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.