CCL13 Antibody - #DF9911
Product: | CCL13 Antibody |
Catalog: | DF9911 |
Description: | Rabbit polyclonal antibody to CCL13 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Dog |
Mol.Wt.: | 11 kDa; 11kD(Calculated). |
Uniprot: | Q99616 |
RRID: | AB_2843105 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9911, RRID:AB_2843105.
Fold/Unfold
C-C motif chemokine 13; CCL13; CCL13_HUMAN; Chemokine (C C motif) ligand 13; CK beta 10; CK-beta-10; CKb10; MCP-4; MGC17134; Monocyte chemoattractant protein 4; Monocyte chemotactic protein 4; NCC 1; NCC-1; NCC1; New CC chemokine 1; SCYA13; SCYL1; short chain; Small inducible cytokine A13 precursor; Small inducible cytokine subfamily A (Cys Cys) member 13; Small-inducible cytokine A13;
Immunogens
Widely expressed. Found in small intestine, thymus, colon, lung, trachea, stomach and lymph node. Low levels seen in the pulmonary artery smooth muscle cells.
- Q99616 CCL13_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens.
One major form (form long), and two minor forms (short chain and medium chain) are produced by differential signal peptide cleavage. The medium chain is about 30-fold less active than the long chain.
Secreted.
Widely expressed. Found in small intestine, thymus, colon, lung, trachea, stomach and lymph node. Low levels seen in the pulmonary artery smooth muscle cells.
Belongs to the intercrine beta (chemokine CC) family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
References
Application: IHC Species: Human Sample: UCEC tumor and the adjacent tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.