Product: CCL1 Antibody
Catalog: DF9910
Description: Rabbit polyclonal antibody to CCL1
Application: WB IHC
Reactivity: Human
Mol.Wt.: 11 kDa; 11kD(Calculated).
Uniprot: P22362
RRID: AB_2843104

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CCL1 Antibody detects endogenous levels of total CCL1.
RRID:
AB_2843104
Cite Format: Affinity Biosciences Cat# DF9910, RRID:AB_2843104.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-C motif chemokine 1; Ccl1; CCL1_HUMAN; Chemokine CC Motif Ligand 1; inflammatory cytokine I-309; P500; SCYA1; SISe; small inducible cytokine A1; Small-inducible cytokine A1; T lymphocyte secreted protein I-309; T lymphocyte secreted protein I-309; T lymphocyte-secreted protein I-309; TCA3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Research Backgrounds

Function:

Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Monomer.

Family&Domains:

Belongs to the intercrine beta (chemokine CC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

References

1). Iron Oxide Nanoparticles Engineered Macrophage-Derived Exosomes for Targeted Pathological Angiogenesis Therapy. ACS nano, 2024 (PubMed: 38412252) [IF=17.1]

Application: WB    Species: Mouse    Sample:

Figure 3 Ferroptosis-inducing and immuno-modulatory properties of ESIONPs@EXO. (A) The protein levels of NOX1, CD71, COX2, and GPX4 in ESIONPs@EXO-treated C166 determined by Western blot. (B) Statistical result of the protein levels in ESIONPs@EXO-treated C166. (C) Relative GSH level in ESIONPs@EXO-treated C166. (D) TEM representative images of mitochondria in C166 cells after treatment with ESIONPs@EXO for 24 h. Scale bar: 500 nm (upper) and 200 nm (lower). (E) Contents of various cytokines/chemokines in ESIONPs@EXO determined by protein array analysis. (F) The protein levels of CCL1, TIMP1, TIMP2, TNFα, IL-6, IL-9, CX3CL1, and CCL3 in EXO and ESIONPs@EXO determined by Western blot. (G) Statistical results of the protein levels in ESIONPs@EXO.

2). A novel lymphatic pattern promotes metastasis of cervical cancer in a hypoxic tumour-associated macrophage-dependent manner. ANGIOGENESIS, 2021 (PubMed: 33484377) [IF=9.8]

Application: IF/ICC    Species: human    Sample: CSCC

Fig. 5 |Sp1high LECs are fundamental to LVEM formation and lymphatic metastasis.i Immunofuorescence staining was applied to analyse Sp1 (purple), CCL1 (red), CD163 (green) and DAPI (blue)expression in CSCC tissues (Scale bar, 50 μm).

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.