SEPT11 Antibody - #DF9880
Product: | SEPT11 Antibody |
Catalog: | DF9880 |
Description: | Rabbit polyclonal antibody to SEPT11 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 49 kDa; 49kD(Calculated). |
Uniprot: | Q9NVA2 |
RRID: | AB_2843074 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9880, RRID:AB_2843074.
Fold/Unfold
SEP11_HUMAN; SEPT 11; Sept11; Septin-11; Septin11;
Immunogens
- Q9NVA2 SEP11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NVA2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
T64 | Phosphorylation | Uniprot | |
K65 | Ubiquitination | Uniprot | |
S84 | Phosphorylation | Uniprot | |
Y85 | Phosphorylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
T145 | Phosphorylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
K175 | Ubiquitination | Uniprot | |
K184 | Ubiquitination | Uniprot | |
Y294 | Phosphorylation | Uniprot | |
Y297 | Phosphorylation | Uniprot | |
K301 | Ubiquitination | Uniprot | |
K308 | Ubiquitination | Uniprot | |
T310 | Phosphorylation | Uniprot | |
S314 | Phosphorylation | Uniprot | |
K315 | Ubiquitination | Uniprot | |
S318 | Phosphorylation | Uniprot | |
Y323 | Phosphorylation | Uniprot | |
K326 | Ubiquitination | Uniprot | |
K336 | Ubiquitination | Uniprot | |
K337 | Ubiquitination | Uniprot | |
K357 | Ubiquitination | Uniprot | |
K361 | Acetylation | Uniprot | |
K366 | Ubiquitination | Uniprot | |
K378 | Acetylation | Uniprot | |
K399 | Ubiquitination | Uniprot | |
S407 | Phosphorylation | Uniprot | |
S412 | Phosphorylation | Uniprot | |
K418 | Ubiquitination | Uniprot |
Research Backgrounds
Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity (By similarity). During Listeria monocytogenes infection, not required for the bacterial entry process, but restricts its efficacy.
Cytoplasm>Cytoskeleton. Cell junction>Synapse. Cell projection>Dendritic spine. Cell projection>Axon.
Note: Partly colocalizes with stress fibers and microtubules. During bacterial infection, displays a collar shape structure next to actin at the pole of invading bacteria.
Widely expressed, except in leukocytes.
Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. Forms homooligomers. GTPase activity is required for filament formation. Interacts with SEPTIN7, SEPTIN9 and SEPTIN12.
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Bacterial invasion of epithelial cells.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.