RGS20 Antibody - #DF9846
| Product: | RGS20 Antibody |
| Catalog: | DF9846 |
| Description: | Rabbit polyclonal antibody to RGS20 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Horse |
| Mol.Wt.: | 44 kDa; 44kD(Calculated). |
| Uniprot: | O76081 |
| RRID: | AB_2843040 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9846, RRID:AB_2843040.
Fold/Unfold
G(z)GAP; Gz selective GTPase activating protein; Gz-GAP; Gz-selective GTPase-activating protein; HGNC:14600; Regulator of G protein signaling 20; Regulator of G-protein signaling 20; Regulator of G-protein signaling Z1; Regulator of Gz selective protein signaling 1; Regulator of Gz-selective protein signaling 1; RGS20; RGS20_HUMAN; RGSZ1; ZGAP1;
Immunogens
Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
- O76081 RGS20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLPDSPAAPKLFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGHEELPGRLSLLLGAALALPGRPSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O76081 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S77 | Phosphorylation | Uniprot | |
| T162 | Phosphorylation | Uniprot | |
| S166 | Phosphorylation | Uniprot | |
| S174 | Phosphorylation | Uniprot | |
| Y315 | Phosphorylation | Uniprot | |
| K384 | Ubiquitination | Uniprot |
Research Backgrounds
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins (By similarity).
Fatty acylated. Heavily palmitoylated in the cysteine string motif (By similarity).
N- and O-glycosylated in synapsomal membranes.
Serine phosphorylated in synapsomal membranes.
Sumoylated with SUMO1 and SUMO2 in synaptosomes. The sumoylated forms act as a scaffold for sequestering mu-opioid receptor-activated G(alpha) subunits (By similarity).
Membrane>Lipid-anchor. Nucleus. Cytoplasm.
Note: Shuttles between the cytoplasm/cell membrane and the nucleus. Anchored to the membrane through palmitoylation.
Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
Forms a complex with G(alpha)z/i2 subunits and mu-opioid receptors; the formation of this complex results in mu-opioid receptor desensitization. Interacts with OPRM1 (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.