RRAS2 Antibody - #DF9840
Product: | RRAS2 Antibody |
Catalog: | DF9840 |
Description: | Rabbit polyclonal antibody to RRAS2 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 23 kDa; 23kD(Calculated). |
Uniprot: | P62070 |
RRID: | AB_2843034 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9840, RRID:AB_2843034.
Fold/Unfold
C86394; Oncogene RRAS2; Oncogene TC21; Ras like protein TC21; Ras related protein R Ras2; Ras-like protein TC21; Ras-related protein R-Ras2; Related RAS viral (r ras) oncogene homolog 2; Related RAS viral oncogene homolog 2; RRAS 2; RRAS2; RRAS2_HUMAN; TC 21; TC21; Teratocarcinoma oncogene; Teratocarcinoma oncogene TC21;
Immunogens
Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
- P62070 RRAS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62070 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S10 | Phosphorylation | Uniprot | |
Y15 | Phosphorylation | Uniprot | |
Y43 | Phosphorylation | Uniprot | |
C55 | S-Nitrosylation | Uniprot | |
Y105 | Phosphorylation | Uniprot | |
K128 | Ubiquitination | Uniprot | |
K177 | Ubiquitination | Uniprot | |
C183 | S-Nitrosylation | Uniprot | |
S186 | Phosphorylation | Uniprot | |
T190 | Phosphorylation | Uniprot | |
K192 | Ubiquitination | Uniprot |
Research Backgrounds
It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
May be post-translationally modified by both palmitoylation and polyisoprenylation.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Note: Inner surface of plasma membrane possibly with attachment requiring acylation of the C-terminal cysteine (By similarity with RAS).
Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
Belongs to the small GTPase superfamily. Ras family.
Research Fields
· Cellular Processes > Transport and catabolism > Autophagy - animal. (View pathway)
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Phospholipase D signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
References
Application: IF/ICC Species: pig Sample: 3D4/2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.