RAB9B Antibody - #DF9838
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9838, RRID:AB_2843032.
Fold/Unfold
RAB 9B; RAB 9L; Rab-9-like protein; Rab-9L; RAB9 like protein; Rab9b; RAB9B_HUMAN; RAB9L; Ras related protein Rab9B; Ras-related protein Rab-9B;
Immunogens
- Q9NP90 RAB9B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NP90 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K4 | Ubiquitination | Uniprot | |
| K20 | Ubiquitination | Uniprot | |
| T63 | Phosphorylation | Uniprot | |
| T86 | Phosphorylation | Uniprot | |
| S88 | Phosphorylation | Uniprot | |
| S94 | Phosphorylation | Uniprot | |
| K103 | Ubiquitination | Uniprot | |
| Y107 | Phosphorylation | Uniprot | |
| Y108 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the transport of proteins between the endosomes and the trans Golgi network.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis.
Ubiquitous.
Interacts (GTP-bound form) with SGSM1; the GDP-bound form has much lower affinity for SGSM1. The GTP-bound form but not the GDP-bound form interacts with HPS4 and the BLOC-3 complex (heterodimer of HPS1 and HPS4) but does not interact with HPS1 alone.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Measles.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.