RAB8B Antibody - #DF9837
| Product: | RAB8B Antibody |
| Catalog: | DF9837 |
| Description: | Rabbit polyclonal antibody to RAB8B |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q92930 |
| RRID: | AB_2843031 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9837, RRID:AB_2843031.
Fold/Unfold
5930437D16; D330025I23Rik; FLJ38125; GTPase Rab8b; RAB 8b protein; RAB44; Rab8b; RAB8B, member RAS oncogene family; RAB8B_HUMAN; Ras-related protein Rab-8B;
Immunogens
- Q92930 RAB8B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92930 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K3 | Acetylation | Uniprot | |
| K3 | Ubiquitination | Uniprot | |
| T4 | Phosphorylation | Uniprot | |
| Y5 | Phosphorylation | Uniprot | |
| Y7 | Phosphorylation | Uniprot | |
| S17 | Phosphorylation | Uniprot | |
| T49 | Phosphorylation | Uniprot | |
| T64 | Phosphorylation | Uniprot | |
| T72 | Phosphorylation | Uniprot | |
| Y77 | Phosphorylation | Uniprot | |
| K100 | Ubiquitination | Uniprot | |
| S111 | Phosphorylation | Uniprot | |
| S112 | Phosphorylation | Uniprot | |
| K122 | Ubiquitination | Uniprot | |
| S132 | Phosphorylation | Uniprot | |
| Y143 | Phosphorylation | Uniprot | |
| K153 | Ubiquitination | Uniprot | |
| T164 | Phosphorylation | Uniprot | |
| K176 | Ubiquitination | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| S182 | Phosphorylation | Uniprot | |
| K190 | Ubiquitination | Uniprot | |
| S200 | Phosphorylation | Uniprot |
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may be involved in polarized vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells (By similarity).
Phosphorylation of Thr-72 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.
Cell membrane>Lipid-anchor>Cytoplasmic side. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis.
Associated with actin, delta-catenin and alpha and beta tubulins (By similarity). Interacts with OTOF (By similarity). Interacts with PEX5R (By similarity). Interacts with RAB3IP. Interacts with VIM (By similarity). Interacts with CDH1 (By similarity). Interacts with MICALL2 (By similarity). Interacts with GDI1, GDI2, CHML and CHM; phosphorylation at Thr-72 disrupts these interactions.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.