RAB5B Antibody - #DF9834
| Product: | RAB5B Antibody |
| Catalog: | DF9834 |
| Description: | Rabbit polyclonal antibody to RAB5B |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | P61020 |
| RRID: | AB_2843028 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9834, RRID:AB_2843028.
Fold/Unfold
Rab 5b; Rab5 b; RAB5B, member RAS oncogene family; Ras related protein Rab 5B; RAS-associated protein RAB5B;
Immunogens
- P61020 RAB5B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61020 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T2 | Acetylation | Uniprot | |
| T6 | Phosphorylation | Q5S007 (LRRK2) | Uniprot |
| K17 | Ubiquitination | Uniprot | |
| K22 | Acetylation | Uniprot | |
| S29 | Phosphorylation | Uniprot | |
| K33 | Ubiquitination | Uniprot | |
| Y82 | Phosphorylation | Uniprot | |
| S84 | Phosphorylation | Uniprot | |
| K116 | Ubiquitination | Uniprot | |
| S123 | Phosphorylation | P06493 (CDK1) | Uniprot |
| S125 | Phosphorylation | Uniprot | |
| K134 | Ubiquitination | Uniprot | |
| K140 | Ubiquitination | Uniprot | |
| S184 | Phosphorylation | Uniprot | |
| S205 | Phosphorylation | Uniprot |
Research Backgrounds
Protein transport. Probably involved in vesicular traffic (By similarity).
Phosphorylation of Ser-84 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.
Cell membrane>Lipid-anchor>Cytoplasmic side. Early endosome membrane>Lipid-anchor. Melanosome.
Note: Enriched in stage I melanosomes.
Binds EEA1. Interacts with RIN2 and RIN3, which probably regulate its pathway, possibly by acting as GEFs. Interacts with GDI1, GDI2, CHML and CHM; phosphorylation at Ser-84 disrupts this interaction.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Environmental Information Processing > Signal transduction > Ras signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Organismal Systems > Excretory system > Vasopressin-regulated water reabsorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.