RAB22A Antibody - #DF9820
Product: | RAB22A Antibody |
Catalog: | DF9820 |
Description: | Rabbit polyclonal antibody to RAB22A |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 22 kDa; 22kD(Calculated). |
Uniprot: | Q9UL26 |
RRID: | AB_2843014 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9820, RRID:AB_2843014.
Fold/Unfold
3732413A17Rik; AI662177; AW319644; AW550514; E130120E14Rik; GTP binding protein RAB22A; MGC16770; OTTMUSP00000017605; Rab 22; RAB 22A; Rab-22; Rab22; RAB22A; RAB22A member RAS oncogene family; Ras related protein Rab 22A; Ras related protein Rab22A; Ras-related protein Rab-22A; RB22A_HUMAN;
Immunogens
- Q9UL26 RB22A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UL26 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K7 | Ubiquitination | Uniprot | |
T14 | Phosphorylation | Uniprot | |
S19 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
K101 | Acetylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
S175 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in endocytosis and intracellular protein transport. Mediates trafficking of TF from early endosomes to recycling endosomes. Required for NGF-mediated endocytosis of NTRK1, and subsequent neurite outgrowth. Binds GTP and GDP and has low GTPase activity. Alternates between a GTP-bound active form and a GDP-bound inactive form.
Endosome membrane>Lipid-anchor. Cell membrane>Lipid-anchor. Early endosome. Late endosome. Cell projection>Ruffle. Cytoplasmic vesicle. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis.
Interacts directly with ZFYVE20 (By similarity). Binds EEA1 (By similarity). Interacts (in its GTP-bound form) with RABGEF1. Interacts (in its GTP-bound form) with RINL.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.