KCNE3 Antibody - #DF9764
| Product: | KCNE3 Antibody |
| Catalog: | DF9764 |
| Description: | Rabbit polyclonal antibody to KCNE3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 12 kDa, 25 kDa; 12kD(Calculated). |
| Uniprot: | Q9Y6H6 |
| RRID: | AB_2842959 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9764, RRID:AB_2842959.
Fold/Unfold
Cardiac voltage gated potassium channel accessory subunit; HOKPP; KCNE 3; Minimum potassium ion channel related peptide 2; minK related peptide 2; MiRP 2; MiRP2; Potassium voltage gated channel subfamily E member 3; Potassium voltage gated channel, Isk related family, member 3; Voltage gated K+ channel subunit MIRP2;
Immunogens
Expressed in hippocampal neurons (at protein level) (PubMed:12954870). Widely expressed with highest levels in kidney and moderate levels in small intestine.
- Q9Y6H6 KCNE3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNC4/Kv3.4 is proposed to form the subthreshold voltage-gated potassium channel in skeletal muscle and to establish the resting membrane potential (RMP) in muscle cells. Associated with KCNQ1/KCLQT1 may form the intestinal cAMP-stimulated potassium channel involved in chloride secretion that produces a current with nearly instantaneous activation with a linear current-voltage relationship.
Cell membrane>Single-pass type I membrane protein. Cytoplasm. Perikaryon. Cell projection>Dendrite. Membrane raft.
Note: Colocalizes with KCNB1 at high-density somatodendritic clusters on the surface of hippocampal neurons.
Expressed in hippocampal neurons (at protein level). Widely expressed with highest levels in kidney and moderate levels in small intestine.
Interacts with KCNB1. Interacts with KCNC2 (By similarity). Associates with KCNC4/Kv3.4. Interacts with KCNQ1; produces a current with nearly instantaneous activation with a linear current-voltage relationship and alters membrane raft localization (By similarity).
Belongs to the potassium channel KCNE family.
Research Fields
· Organismal Systems > Digestive system > Protein digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.