KCNE1L Antibody - #DF9763
| Product: | KCNE1L Antibody |
| Catalog: | DF9763 |
| Description: | Rabbit polyclonal antibody to KCNE1L |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit |
| Mol.Wt.: | 15 kDa; 15kD(Calculated). |
| Uniprot: | Q9UJ90 |
| RRID: | AB_2842958 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9763, RRID:AB_2842958.
Fold/Unfold
1500015C14Rik; AMME syndrome candidate gene 2 protein; AMMECR2 protein; Cardiac voltage gated potassium channel accessory subunit 5; KCNE1 like; KCNE5; Mink; MinK like protein; Potassium voltage gated channel subfamily E member 1 like protein; Potassium voltage gated channel, Isk related family, member 1 like; Voltage gated potassium channel accessory subunit 5;
Immunogens
- Q9UJ90 KCNE5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.
Membrane>Single-pass type I membrane protein.
Highly expressed in heart, skeletal muscle, brain, spinal cord and placenta.
Interacts with KCNQ1; impairs KCNQ1 localization in lipid rafts and only conducts current upon strong and continued depolarization.
Belongs to the potassium channel KCNE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.