CD42c/GP1BB Antibody - #DF9759
| Product: | CD42c/GP1BB Antibody |
| Catalog: | DF9759 |
| Description: | Rabbit polyclonal antibody to CD42c/GP1BB |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Monkey |
| Prediction: | Bovine, Dog |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | P13224 |
| RRID: | AB_2842954 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9759, RRID:AB_2842954.
Fold/Unfold
Antigen CD42b beta; BDPLT1; BS; CD_antigen=CD42c; Flags: Precursor; Glycoprotein Ib (platelet) beta polypeptide; Glycoprotein Ib beta polypeptide; GP Ib beta; GP Ib beta subunit; GP1BB; GP1bbeta; GPIb beta; Nuclear localization signal deleted in velocardiofacial syndrome; Platelet glycoprotein Ib beta chain; Platelet glycoprotein Ib beta polypeptide;
Immunogens
- P13224 GP1BB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P13224 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N66 | N-Glycosylation | Uniprot | |
| T83 | O-Glycosylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| T193 | Phosphorylation | Uniprot | |
| T203 | Phosphorylation | Uniprot |
Research Backgrounds
Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.
Membrane>Single-pass type I membrane protein.
Expressed in heart and brain.
Two GP-Ib beta are disulfide-linked to one GP-Ib alpha. GP-IX is complexed with the GP-Ib heterodimer via a non covalent linkage.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction. (View pathway)
· Organismal Systems > Immune system > Platelet activation. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.