P2RX1 Antibody - #DF9728
Product: | P2RX1 Antibody |
Catalog: | DF9728 |
Description: | Rabbit polyclonal antibody to P2RX1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 45 kDa; 45kD(Calculated). |
Uniprot: | P51575 |
RRID: | AB_2842923 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9728, RRID:AB_2842923.
Fold/Unfold
ATP receptor; H.sapiens mRNA for ATP receptor; P2 RX1; P2rx1; P2RX1 protein; P2RX1_HUMAN; P2X purinoceptor 1; P2X receptor subunit 1; P2X1; P2X1 receptor; Purinergic receptor; Purinergic receptor P2X ligand gated ion channel 1; Purinergic receptor P2X1;
Immunogens
- P51575 P2RX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P51575 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y16 | Phosphorylation | Uniprot | |
T18 | Phosphorylation | Uniprot | |
S130 | Phosphorylation | Uniprot | |
K138 | Acetylation | Uniprot | |
Y274 | Phosphorylation | Uniprot | |
S286 | Phosphorylation | Uniprot | |
Y370 | Phosphorylation | Uniprot | |
T386 | Phosphorylation | Uniprot | |
S387 | Phosphorylation | Uniprot | |
S388 | Phosphorylation | Uniprot | |
T389 | Phosphorylation | Uniprot | |
T398 | Phosphorylation | Uniprot | |
S399 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Seems to be linked to apoptosis, by increasing the intracellular concentration of calcium in the presence of ATP, leading to programmed cell death (By similarity).
Membrane>Multi-pass membrane protein.
Homo- or heteropolymers.
Belongs to the P2X receptor family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
· Organismal Systems > Immune system > Platelet activation. (View pathway)
References
Application: WB Species: Human Sample: breast cancer cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.