Product: MT-ND6 Antibody
Catalog: DF9676
Description: Rabbit polyclonal antibody to MT-ND6
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 19 kDa; 19kD(Calculated).
Uniprot: P03923
RRID: AB_2842872

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
MT-ND6 Antibody detects endogenous levels of total MT-ND6.
RRID:
AB_2842872
Cite Format: Affinity Biosciences Cat# DF9676, RRID:AB_2842872.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Mitochondrially encoded NADH dehydrogenase 6; MT ND6; mtND6; NADH dehydrogenase subunit 6 (complex I); NADH ubiquinone oxidoreductase chain 6; NADH Ubiquinone Oxidoreductase subunit ND6; NADH6; ND6;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

Research Backgrounds

Function:

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).

Subcellular Location:

Mitochondrion membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the complex I subunit 6 family.

Research Fields

· Human Diseases > Neurodegenerative diseases > Parkinson's disease.

· Metabolism > Energy metabolism > Oxidative phosphorylation.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling.   (View pathway)

References

1). Mitochondrial miR-181a-5p promotes glucose metabolism reprogramming in liver cancer by regulating the electron transport chain. CARCINOGENESIS, 2020 (PubMed: 31628462) [IF=4.7]

Application: WB    Species: mouse    Sample: HCC and adjacent normal tissues

Figure 1. |Mitochondrial genome and mitomiR expression profile in HCC and adjacent normal tissues. (A) Heatmap displaying mitochondrial genome transcripts. (B) qRT-PCR analysis of mitochondrially transcribed mRNAs. 12S rRNA served as the internal control to normalize the data. *P < 0.05 was considered statistically significant. (C) Western blotting of mt-ND1, mt-ND5, mt-ND6, mt-CYB, mt-CO2 and mt-ATP8. VADC1/Porin served as the internal control. *P < 0.05 was considered statistically significant.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.