NDUFA6 Antibody - #DF9661
| Product: | NDUFA6 Antibody |
| Catalog: | DF9661 |
| Description: | Rabbit polyclonal antibody to NDUFA6 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 18 kDa; 15kD(Calculated). |
| Uniprot: | P56556 |
| RRID: | AB_2842857 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9661, RRID:AB_2842857.
Fold/Unfold
B14; CI-B14; complex I B14 subunit; Complex I-B14; LYR motif-containing protein 6; LYRM6; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6 (14kD, B14); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6; NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6; NADH-ubiquinone oxidoreductase B14 subunit; NADHB14; NDUA6_HUMAN; NDUFA6;
Immunogens
- P56556 NDUA6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P56556 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S11 | Phosphorylation | Uniprot | |
| K18 | Ubiquitination | Uniprot | |
| R77 | Methylation | Uniprot | |
| K85 | Ubiquitination | Uniprot | |
| T93 | Phosphorylation | Uniprot | |
| K116 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot |
Research Backgrounds
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Mammalian complex I is composed of 45 different subunits.
Belongs to the complex I LYR family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).
· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.
· Human Diseases > Neurodegenerative diseases > Parkinson's disease.
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
· Metabolism > Energy metabolism > Oxidative phosphorylation.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Nervous system > Retrograde endocannabinoid signaling. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.