IMMP1L Antibody - #DF9629
| Product: | IMMP1L Antibody |
| Catalog: | DF9629 |
| Description: | Rabbit polyclonal antibody to IMMP1L |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Horse, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 19 kDa; 19kD(Calculated). |
| Uniprot: | Q96LU5 |
| RRID: | AB_2842825 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9629, RRID:AB_2842825.
Fold/Unfold
Immp1l; IMP 1; IMP 1 like; IMP1; IMP1 inner mitochondrial membrane peptidase like; IMP1 like; IMP1-like protein; IMP1L_HUMAN; Mitochondrial inner membrane protease subunit 1;
Immunogens
- Q96LU5 IMP1L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96LU5 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S104 | Phosphorylation | Uniprot | |
| S106 | Phosphorylation | Uniprot | |
| Y107 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.
Mitochondrion inner membrane.
Heterodimer of 2 subunits, IMMPL1 and IMMPL2.
Belongs to the peptidase S26 family. IMP1 subfamily.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein export.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.