KIR2DL5A Antibody - #DF9600
Product: | KIR2DL5A Antibody |
Catalog: | DF9600 |
Description: | Rabbit polyclonal antibody to KIR2DL5A |
Application: | WB IHC |
Reactivity: | Human, Rat |
Mol.Wt.: | 41 kDa; 41kD(Calculated). |
Uniprot: | Q8N109 |
RRID: | AB_2842796 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9600, RRID:AB_2842796.
Fold/Unfold
CD158F; CD158f1; KI2LA_HUMAN; Killer cell immunoglobulin-like receptor 2DL5A; killer cell immunoglobulin-like receptor KIR2DL5A; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A; killer-cell Ig-like receptor; KIR2DL5; KIR2DL5.1; KIR2DL5.3; KIR2DL5A; KIR2DL5B;
Immunogens
- Q8N109 KI2LA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
PTMs - Q8N109 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T92 | Phosphorylation | Uniprot | |
Y93 | Phosphorylation | Uniprot | |
T141 | Phosphorylation | Uniprot | |
S148 | Phosphorylation | Uniprot | |
S149 | Phosphorylation | Uniprot | |
Y153 | Phosphorylation | Uniprot | |
K319 | Ubiquitination | Uniprot | |
K335 | Ubiquitination | Uniprot | |
K344 | Ubiquitination | Uniprot |
Research Backgrounds
Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
Cell membrane>Single-pass type I membrane protein.
Belongs to the immunoglobulin superfamily.
Research Fields
· Cellular Processes > Cell growth and death > Cellular senescence. (View pathway)
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.