NKX22 Antibody - #DF9587
| Product: | NKX22 Antibody |
| Catalog: | DF9587 |
| Description: | Rabbit polyclonal antibody to NKX22 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 30 kDa; 30kD(Calculated). |
| Uniprot: | O95096 |
| RRID: | AB_2842783 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9587, RRID:AB_2842783.
Fold/Unfold
Homeobox protein NK 2 homolog B; Homeobox protein NK-2 homolog B; Homeobox protein Nkx 2.2; Homeobox protein Nkx-2.2; NK 2 homolog B; NK2 homeobox 2; NK2 transcription factor like protein B; NK2 transcription factor related locus 2; NKX2 2; NKX2-2; NKX22; NKX22_HUMAN; Nkx2b; tinman;
Immunogens
- O95096 NKX22_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95096 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T6 | Phosphorylation | Uniprot | |
| T8 | Phosphorylation | Uniprot | |
| S11 | Phosphorylation | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| K137 | Ubiquitination | Uniprot | |
| Y152 | Phosphorylation | Uniprot | |
| S163 | Phosphorylation | Uniprot | |
| S199 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas (By similarity). May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter (By similarity).
Nucleus.
Interacts with OLIG2.
The homeodomain is essential for interaction with OLIG2.
Belongs to the NK-2 homeobox family.
Research Fields
· Human Diseases > Endocrine and metabolic diseases > Maturity onset diabetes of the young.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.