HOXC13 Antibody - #DF9582
| Product: | HOXC13 Antibody |
| Catalog: | DF9582 |
| Description: | Rabbit polyclonal antibody to HOXC13 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Chicken |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | P31276 |
| RRID: | AB_2842778 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9582, RRID:AB_2842778.
Fold/Unfold
ECTD9; Homeo box 3G; Homeo box C13; homeobox C13; Homeobox protein Hox 3G; Homeobox protein Hox-3G; Homeobox protein Hox-C13; Homeobox protein Hox-C13a; Hox-3G; HOX3; HOX3G; Hoxc13; HXC13; HXC13_HUMAN; NUP98; NUP98/HOXC13;
Immunogens
- P31276 HXC13_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLWKSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLSERQVTIWFQNRRVKEKKVVSKSKAPHLHST
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31276 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S234 | Phosphorylation | Uniprot | |
| K241 | Ubiquitination | Uniprot | |
| K273 | Ubiquitination | Uniprot | |
| S294 | Phosphorylation | Uniprot | |
| T296 | Phosphorylation | Uniprot | |
| S300 | Phosphorylation | Uniprot |
Research Backgrounds
Transcription factor which plays a role in hair follicle differentiation. Regulates FOXQ1 expression and that of other hair-specific genes (By similarity).
Nucleus.
Belongs to the Abd-B homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.