HOXB1 Antibody - #DF9576
| Product: | HOXB1 Antibody |
| Catalog: | DF9576 |
| Description: | Rabbit polyclonal antibody to HOXB1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 32 kDa; 32kD(Calculated). |
| Uniprot: | P14653 |
| RRID: | AB_2842772 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9576, RRID:AB_2842772.
Fold/Unfold
HCFP3; Homeo box 2I; Homeo box B1; Homeobox 2I; Homeobox B1; Homeobox protein Hox B1; Homeobox protein Hox-2I; Homeobox protein Hox-B1; Homeobox protein HoxB1; Homeobox2I; HomeoboxB1; HOX 2; Hox 2.9; HOX 2I; HOX B1; HOX2; Hox2.9; HOX2I; HOXB 1; HOXB1; HOXB1 protein; HXB1_HUMAN; MGC116843; MGC116844; MGC116845;
Immunogens
- P14653 HXB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREEGRVPPAPPGCPKEAAGDASDQSTCTSPEASPSSVTS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P14653 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K277 | Acetylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
Nucleus.
Belongs to the Antp homeobox family. Labial subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.