HNRPDL Antibody - #DF9571
Product: | HNRPDL Antibody |
Catalog: | DF9571 |
Description: | Rabbit polyclonal antibody to HNRPDL |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 46 kDa,37kDa; 46kD(Calculated). |
Uniprot: | O14979 |
RRID: | AB_2842767 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9571, RRID:AB_2842767.
Fold/Unfold
A+U-rich element RNA binding factor; AA407431; AA959857; AU rich element RNA binding factor; AU-rich element RNA-binding factor; D5Ertd650e; D5Wsu145e; Heterogeneous nuclear ribonucleoprotein D like; Heterogeneous nuclear ribonucleoprotein D like protein; Heterogeneous nuclear ribonucleoprotein D-like; hnHNRP DL; HNRDL_HUMAN; HNRNP; hnRNP D-like; hnRNP DL; HNRNPDL; hnRPD like protein; JKT41 binding protein; JKT41-binding protein; JKTBP; JKTBP2; laAUF1; MGC125262; Protein laAUF1;
Immunogens
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Expressed in myeloid leukemia, gastric adenocarcinoma, cervical carcinoma, hepatoma, fibrosarcoma, colon adenocarcinoma, epidermoid carcinoma, osteosarcoma and urinary bladder carcinoma cells.
- O14979 HNRDL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O14979 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
R6 | Methylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
R25 | Methylation | Uniprot | |
R68 | Methylation | Uniprot | |
K76 | Methylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
R81 | Methylation | Uniprot | |
R82 | Methylation | Uniprot | |
S94 | Phosphorylation | Uniprot | |
S98 | Phosphorylation | Uniprot | |
S117 | Phosphorylation | Uniprot | |
T119 | Phosphorylation | Uniprot | |
Y126 | Phosphorylation | Uniprot | |
S127 | Phosphorylation | Uniprot | |
S136 | Phosphorylation | Uniprot | |
K137 | Acetylation | Uniprot | |
K137 | Ubiquitination | Uniprot | |
K142 | Ubiquitination | Uniprot | |
K149 | Ubiquitination | Uniprot | |
S156 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
K161 | Acetylation | Uniprot | |
K161 | Methylation | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K162 | Ubiquitination | Uniprot | |
T165 | Phosphorylation | Uniprot | |
Y167 | Phosphorylation | Uniprot | |
S169 | Phosphorylation | Uniprot | |
C177 | S-Nitrosylation | Uniprot | |
T178 | Phosphorylation | Uniprot | |
K180 | Acetylation | Uniprot | |
K180 | Ubiquitination | Uniprot | |
R189 | Methylation | Uniprot | |
K197 | Acetylation | Uniprot | |
K197 | Ubiquitination | Uniprot | |
K204 | Acetylation | Uniprot | |
K204 | Ubiquitination | Uniprot | |
K209 | Ubiquitination | Uniprot | |
K216 | Acetylation | Uniprot | |
K216 | Ubiquitination | Uniprot | |
K234 | Ubiquitination | Uniprot | |
S241 | Phosphorylation | Uniprot | |
T244 | Phosphorylation | Uniprot | |
K269 | Ubiquitination | Uniprot | |
K288 | Ubiquitination | Uniprot | |
Y295 | Phosphorylation | Uniprot | |
S300 | Phosphorylation | Uniprot | |
K302 | Acetylation | Uniprot | |
K302 | Ubiquitination | Uniprot | |
K306 | Ubiquitination | Uniprot | |
K311 | Ubiquitination | Uniprot | |
Y314 | Phosphorylation | Uniprot | |
Y387 | Phosphorylation | Uniprot | |
Y389 | Phosphorylation | Uniprot | |
Y396 | Phosphorylation | Uniprot | |
R408 | Methylation | Uniprot | |
Y417 | Phosphorylation | Uniprot | |
Y420 | Phosphorylation | Uniprot |
Research Backgrounds
Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes (By similarity). Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter (By similarity). Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.
Dimethylation of Arg-408 is probably of the asymmetric type.
Nucleus. Cytoplasm.
Note: Shuttles between the nucleus and the cytoplasm in a TNPO1-dependent manner.
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Expressed in myeloid leukemia, gastric adenocarcinoma, cervical carcinoma, hepatoma, fibrosarcoma, colon adenocarcinoma, epidermoid carcinoma, osteosarcoma and urinary bladder carcinoma cells.
Interacts with ZNF148 (By similarity). Interacts with TNPO1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.