GCH1 Antibody - #DF9546
| Product: | GCH1 Antibody |
| Catalog: | DF9546 |
| Description: | Rabbit polyclonal antibody to GCH1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 28 kDa, 23 kDa; 28kD(Calculated). |
| Uniprot: | P30793 |
| RRID: | AB_2842742 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9546, RRID:AB_2842742.
Fold/Unfold
dystonia 14; DYT 5; DYT14; DYT5; DYT5a; GCH 1; GCH; Gch1; GCH1_HUMAN; GTP CH 1; GTP CH I; GTP cyclohydrolase 1 (dopa responsive dystonia); GTP cyclohydrolase 1; GTP cyclohydrolase I; GTP-CH-I; GTPCH 1; GTPCH1; Guanosine 5' triphosphate cyclohydrolase I; HPABH4B;
Immunogens
In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
- P30793 GCH1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P30793 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K38 | Ubiquitination | Uniprot | |
| K54 | Ubiquitination | Uniprot | |
| S60 | Phosphorylation | Uniprot | |
| S81 | Phosphorylation | Uniprot | |
| K93 | Ubiquitination | Uniprot | |
| K160 | Ubiquitination | Uniprot | |
| Y175 | Phosphorylation | Uniprot |
Research Backgrounds
Positively regulates nitric oxide synthesis in umbilical vein endothelial cells (HUVECs). May be involved in dopamine synthesis. May modify pain sensitivity and persistence. Isoform GCH-1 is the functional enzyme, the potential function of the enzymatically inactive isoforms remains unknown.
Phosphorylated by casein kinase II at Ser-81 in HAECs during oscillatory shear stress; phosphorylation at Ser-81 results in increased enzyme activity.
Cytoplasm. Nucleus.
In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
Toroid-shaped homodecamer, composed of a dimer of pentamers. The inactive isoforms also form decamers and may possibly be incorporated into GCH1 heterodecamers, decreasing enzyme stability and activity. Interacts with AHSA1 and GCHFR/GFRP.
Belongs to the GTP cyclohydrolase I family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Folate biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.