FUT2 Antibody - #DF9523
| Product: | FUT2 Antibody |
| Catalog: | DF9523 |
| Description: | Rabbit polyclonal antibody to FUT2 |
| Application: | WB |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 39 kDa; 39kD(Calculated). |
| Uniprot: | Q10981 |
| RRID: | AB_2842719 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9523, RRID:AB_2842719.
Fold/Unfold
2)FT 2; Alpha (1,2) fucosyltransferase; Alpha(1; Alpha(1,2)FT 2; Alpha(1,2)FT2; B12QTL1; fucosyltransferase 2 (secretor status included); Fucosyltransferase 2; FUT2; FUT2_HUMAN; Galactoside 2-alpha-L-fucosyltransferase 2; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2; SE; SE2; SEC2; Secretor blood group alpha-2-fucosyltransferase; Secretor factor; Sej;
Immunogens
- Q10981 FUT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q10981 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y205 | Phosphorylation | Uniprot |
Research Backgrounds
Mediates the transfer of fucose to the terminal galactose on glycan chains of cell surface glycoproteins and glycolipids. The resulting epitope plays a role in cell-cell interaction including host-microbe interaction. Mediates interaction with intestinal microbiota influencing its composition. Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble ABO blood group antigen synthesis pathway.
Golgi apparatus>Golgi stack membrane>Single-pass type II membrane protein.
Note: Membrane-bound form in trans cisternae of Golgi.
Small intestine, colon and lung.
Belongs to the glycosyltransferase 11 family.
Research Fields
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - lacto and neolacto series.
· Metabolism > Glycan biosynthesis and metabolism > Glycosphingolipid biosynthesis - globo and isoglobo series.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.