Product: FOLR3 Antibody
Catalog: DF9519
Description: Rabbit polyclonal antibody to FOLR3
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 25,37 kDa; 28kD(Calculated).
Uniprot: P41439
RRID: AB_2842715

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
FOLR3 Antibody detects endogenous levels of total FOLR3.
RRID:
AB_2842715
Cite Format: Affinity Biosciences Cat# DF9519, RRID:AB_2842715.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Folate receptor 3 (gamma); Folate receptor 3; Folate receptor gamma; FOLR3; FOLR3_HUMAN; FR G; FR-gamma; Gamma hFR;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P41439 FOLR3_HUMAN:

Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.

Sequence:
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

PTMs - P41439 As Substrate

Site PTM Type Enzyme
S194 Phosphorylation
S196 Phosphorylation

Research Backgrounds

Function:

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.

Family&Domains:

Belongs to the folate receptor family.

Research Fields

· Cellular Processes > Transport and catabolism > Endocytosis.   (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

References

1). Reactive oxygen species-responsive dexamethasone-loaded nanoparticles for targeted treatment of rheumatoid arthritis via suppressing the iRhom2/TNF-α/BAFF signaling pathway. Biomaterials (PubMed: 31918224) [IF=14.0]

Application: WB    Species: Mouse    Sample: Raw264.7 and MH7A cells

Fig. 3. In vitro cellular uptake of Cy5-labeled NPs. (A) Raw264.7 macrophages induced with LPS (1 μg/mL) for 6 h. Then cellular uptake of Cy5-labeled Dex/Oxi- αCD NPs or Dex/FA-Oxi-αCD NPs was assessed using confocal laser scanning microscopy at various times. Nuclei were counterstained with DAPI (blue). Scale bars, 20 μm. (B) Quantitative analysis of the corresponding fluorescence intensity of intracellular NPs (red) in Raw264.7 cells. (C) The mRNA expression of FRα, FRβ, and FRγ in MH7A cells were analyzed by quantitative real-time PCR. Data were presented by the relative amount of mRNA normalized by GAPDH. (D) Western blot analysis of FRα, FRβ and FRγ expression in Raw264.7 and MH7A cells. α-Tubulin was used as a loading control. (E–F) Cellular uptake (E) and corresponding fluorescence intensity (F) of Cy5-labeled Dex/Oxi-NPs or Dex/FA-Oxi-NPs in MH7A cells at various time points. *p < 0.05. (For interpretation of the references to colour in this figure legend, the reader is referred to the Web version of this article.)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.