EIF5 Antibody - #DF9511
Product: | EIF5 Antibody |
Catalog: | DF9511 |
Description: | Rabbit polyclonal antibody to EIF5 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 49 kDa; 49kD(Calculated). |
Uniprot: | P55010 |
RRID: | AB_2842707 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9511, RRID:AB_2842707.
Fold/Unfold
2810011H21Rik; D12Ertd549e; EIF 5; EIF 5A; eIF-5; Eif5; Eukaryotic initiation factor 5; Eukaryotic translation initiation factor 5; IF5_HUMAN; MGC36374; MGC36509;
Immunogens
- P55010 IF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P55010 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
S8 | Phosphorylation | Uniprot | |
S10 | Phosphorylation | Uniprot | |
Y14 | Phosphorylation | Uniprot | |
Y16 | Phosphorylation | Uniprot | |
K24 | Acetylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
K28 | Acetylation | Uniprot | |
K33 | Acetylation | Uniprot | |
K55 | Acetylation | Uniprot | |
K55 | Ubiquitination | Uniprot | |
K70 | Ubiquitination | Uniprot | |
K95 | Ubiquitination | Uniprot | |
K114 | Ubiquitination | Uniprot | |
K115 | Ubiquitination | Uniprot | |
S121 | Phosphorylation | Uniprot | |
T139 | Phosphorylation | Uniprot | |
S149 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
S174 | Phosphorylation | P67870 (CSNK2B) , P68400 (CSNK2A1) | Uniprot |
S175 | Phosphorylation | Uniprot | |
S176 | Phosphorylation | Uniprot | |
T178 | Phosphorylation | Uniprot | |
T207 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
T208 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S220 | Phosphorylation | Uniprot | |
T227 | Phosphorylation | Uniprot | |
S229 | Phosphorylation | Uniprot | |
K261 | Ubiquitination | Uniprot | |
K288 | Ubiquitination | Uniprot | |
Y362 | Phosphorylation | Uniprot | |
K369 | Acetylation | Uniprot | |
S389 | Phosphorylation | P67870 (CSNK2B) , P68400 (CSNK2A1) | Uniprot |
S390 | Phosphorylation | P68400 (CSNK2A1) , P67870 (CSNK2B) | Uniprot |
Y405 | Phosphorylation | Uniprot | |
S406 | Phosphorylation | Uniprot | |
S410 | Phosphorylation | Uniprot | |
T416 | Phosphorylation | Uniprot | |
S419 | Phosphorylation | Uniprot |
Research Backgrounds
Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).
Interacts with FMR1 isoform 6; this interaction occurs in a RNA-dependent manner.
Belongs to the eIF-2-beta/eIF-5 family.
Research Fields
· Genetic Information Processing > Translation > RNA transport.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.