HSD17B8 Antibody - #DF9506
| Product: | HSD17B8 Antibody |
| Catalog: | DF9506 |
| Description: | Rabbit polyclonal antibody to HSD17B8 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 27 kDa; 27kD(Calculated). |
| Uniprot: | Q92506 |
| RRID: | AB_2842702 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9506, RRID:AB_2842702.
Fold/Unfold
17 beta HSD 8; 17 beta hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-hydroxysteroid dehydrogenase VIII; 3-oxoacyl-[acyl-carrier-protein] reductase; 3-oxoacyl-acyl-carrier protein reductase, E. coli, homolog of; Beta ketoacyl [acyl carrier protein] reductase like; D6S2245E; DHB8_HUMAN; dJ1033B10.9; Estradiol 17 beta dehydrogenase 8; Estradiol 17-beta-dehydrogenase 8; Estrogen 17 oxidoreductase; FABG; FabG, E. coli, homolog of; FabG-like; FABGL; H2 KE6; H2-KE6; HKE6; HSD17B8; Hydroxysteroid (17 beta) dehydrogenase 8; Ke-6; KE6; KE6, mouse homolog of; Protein Ke6; Really interesting new gene 2 protein; RING2; SDR30C1; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17 beta dehydrogenase 8; Testosterone 17-beta-dehydrogenase 8;
Immunogens
Highly expressed in placenta, liver and pancreas, lower in the skeletal muscle and kidney. Widely expressed.
- Q92506 DHB8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92506 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S21 | Phosphorylation | Uniprot | |
| S60 | Phosphorylation | Uniprot | |
| Y169 | Phosphorylation | Uniprot | |
| K173 | Ubiquitination | Uniprot |
Research Backgrounds
NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heterotetramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis. Within the heterotetramer, HSD17B8 binds NADH; CBR4 binds NADPD.
Mitochondrion matrix.
Highly expressed in placenta, liver and pancreas, lower in the skeletal muscle and kidney. Widely expressed.
Heterotetramer with CBR4; contains two molecules of HSD17B8 and CBR4.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.