ELOVL2 Antibody - #DF9495
Product: | ELOVL2 Antibody |
Catalog: | DF9495 |
Description: | Rabbit polyclonal antibody to ELOVL2 |
Application: | WB |
Reactivity: | Human |
Prediction: | Zebrafish, Horse, Rabbit, Dog, Xenopus |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | Q9NXB9 |
RRID: | AB_2842691 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9495, RRID:AB_2842691.
Fold/Unfold
3 keto acyl CoA synthase ELOVL2; 3-keto acyl-CoA synthase Elovl2; Elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 2; Elongation of very long chain fatty acids protein 2; ELOV2_HUMAN; ELOVL fatty acid elongase 2; Elovl2; FLJ20334; OTTHUMP00000016029; SSC2;
Immunogens
- Q9NXB9 ELOV2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NXB9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K293 | Acetylation | Uniprot |
Research Backgrounds
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA), acting specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. May participate in the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Endoplasmic reticulum membrane>Multi-pass membrane protein.
Liver and testis.
The C-terminal di-lysine motif may confer endoplasmic reticulum localization.
Belongs to the ELO family. ELOVL2 subfamily.
Research Fields
· Metabolism > Lipid metabolism > Fatty acid elongation.
· Metabolism > Lipid metabolism > Biosynthesis of unsaturated fatty acids.
· Metabolism > Global and overview maps > Fatty acid metabolism.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.