RNF5 Antibody - #DF9490
| Product: | RNF5 Antibody |
| Catalog: | DF9490 |
| Description: | Rabbit polyclonal antibody to RNF5 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | Q99942 |
| RRID: | AB_2842686 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9490, RRID:AB_2842686.
Fold/Unfold
E3 ubiquitin protein ligase RNF5; E3 ubiquitin-protein ligase RNF5; G16; HsRma1; NG2; OTTHUMP00000029107; Protein G16; Ram1 homolog; RING finger protein 5; RING5; RMA1; RNF 5; RNF5; RNF5_HUMAN;
Immunogens
- Q99942 RNF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99942 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| K75 | Ubiquitination | Uniprot | |
| S84 | Phosphorylation | Uniprot | |
| K86 | Ubiquitination | Uniprot | |
| K93 | Ubiquitination | Uniprot | |
| T94 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot |
Research Backgrounds
Has E2-dependent E3 ubiquitin-protein ligase activity. May function together with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. Mediates ubiquitination of PXN/paxillin and Salmonella type III secreted protein sopA. May be involved in regulation of cell motility and localization of PXN/paxillin. Mediates the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD; the ubiquitination appears to involve E2 ubiquitin-conjugating enzyme UBE2N. Mediates the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leading to its proteasomal degradation; the ubiquitination occurs in mitochondria after viral transfection and regulates antiviral responses.
Membrane>Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane.
Note: Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.
Widely expressed.
Interacts with PXN. Interacts with Salmonella typhimurium sopA. Interacts with JKAMP. Interacts with STING1; the interaction of endogenous proteins is dependent on viral infection.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.