Product: POLR1D Antibody
Catalog: DF9464
Description: Rabbit polyclonal antibody to POLR1D
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15 kDa; 14kD,15kD(Calculated).
Uniprot: Q9Y2S0 | P0DPB5 | P0DPB6
RRID: AB_2842660

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
POLR1D Antibody detects endogenous levels of total POLR1D.
RRID:
AB_2842660
Cite Format: Affinity Biosciences Cat# DF9464, RRID:AB_2842660.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AC19; DNA directed RNA polymerase I 16 kDa polypeptide; DNA directed RNA polymerase I subunit D; DNA directed RNA polymerases I and III subunit RPAC2; DNA-directed RNA polymerase I subunit D; DNA-directed RNA polymerases I and III subunit RPAC2; FLJ20616; hRPA19; MGC9850; POLR1C; POLR1D; Polymerase (RNA) I polypeptide D; Polymerase (RNA) I polypeptide D, 16kDa; RNA polymerase I 16 kDa subunit; RNA polymerases I and III subunit AC2; RPA16; RPA9; RPAC2; RPAC2_HUMAN; RPC16; RPO1 3;

Immunogens

Immunogen:

A synthesized peptide derived from human POLR1D, corresponding to a region within C-terminal amino acids.

Uniprot:
Sequence:
MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Research Backgrounds

Function:

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Component of the RNA polymerase I (Pol I) and RNA polymerase III (Pol III) complexes consisting of at least 13 and 17 subunits, respectively.

Family&Domains:

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

Research Fields

· Genetic Information Processing > Transcription > RNA polymerase.

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Metabolism > Nucleotide metabolism > Purine metabolism.

· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

References

1). POLR1D promotes colorectal cancer progression and predicts poor prognosis of patients. MOLECULAR CARCINOGENESIS, 2019 (PubMed: 30582221) [IF=4.6]

Application: WB    Species: human    Sample: HCT116 and LOVO cells

Fig.3 |POLR1D knockdown inhibited proliferation and migration of CRC cells. (A) HCT116 and LOVO cells were infected with lentiviral POLR1D shRNA (KD) or a negative control shRNA (NC).The mRNA level of POLR1D was measured by reverse-transcription PCR. (B) POLR1D protein level in HCT116 and LOVO cells infected with lentiviral POLR1D shRNA (KD) or a negative control shRNA (NC)were confirmed by Western blotting.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.