TWISTNB Antibody - #DF9456
Product: | TWISTNB Antibody |
Catalog: | DF9456 |
Description: | Rabbit polyclonal antibody to TWISTNB |
Application: | WB |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 37 kDa; 37kD(Calculated). |
Uniprot: | Q3B726 |
RRID: | AB_2842652 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9456, RRID:AB_2842652.
Fold/Unfold
DNA directed RNA polymerase I subunit RPA43; DNA-directed RNA polymerase I subunit RPA43; RPA43; RPA43_HUMAN; TWIST neighbor; Twist neighbor protein; Twistnb;
Immunogens
Widely expressed. Expressed in all fetal and adult tissues tested, with highest expression in fetal lung, liver, and kidney, and low expression in all adult tissues.
- Q3B726 RPA43_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKKKKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAEFTPPLKCSPKRKGKSNFL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q3B726 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S6 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
T215 | Phosphorylation | Uniprot | |
Y238 | Phosphorylation | Uniprot | |
S242 | Phosphorylation | Uniprot | |
T254 | Phosphorylation | Uniprot | |
S297 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot | |
S300 | Phosphorylation | Uniprot | |
Y302 | Phosphorylation | Uniprot | |
S304 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
T322 | Phosphorylation | Uniprot | |
S328 | Phosphorylation | Uniprot |
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters.
Nucleus>Nucleolus.
Widely expressed. Expressed in all fetal and adult tissues tested, with highest expression in fetal lung, liver, and kidney, and low expression in all adult tissues.
Component of the RNA polymerase I (Pol I) complex consisting of at least 13 subunits (By similarity). Interacts with RRN3/TIF-IA.
Belongs to the eukaryotic RPA43 RNA polymerase subunit family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.