ZNRD1 Antibody - #DF9455
| Product: | ZNRD1 Antibody |
| Catalog: | DF9455 |
| Description: | Rabbit polyclonal antibody to ZNRD1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 14 kDa(Observed); 14kD(Calculated). |
| Uniprot: | Q9P1U0 |
| RRID: | AB_2842651 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9455, RRID:AB_2842651.
Fold/Unfold
DNA directed RNA polymerase I subunit RPA12; DNA-directed RNA polymerase I subunit RPA12; HTEX 6; hZR14; RNA polymerase I small specific subunit Rpa12; RPA12; RPA12_HUMAN; tctex 6; TCTEX6; TEX6; Transcription associated zinc ribbon protein; Zinc ribbon domain containing 1; Zinc ribbon domain containing protein 1; Zinc ribbon domain-containing protein 1; ZNRD1; ZR14;
Immunogens
A synthesized peptide derived from human ZNRD1, corresponding to a region within the internal amino acids.
- Q9P1U0 RPA12_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.
Nucleus>Nucleolus.
Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
Research Fields
· Genetic Information Processing > Transcription > RNA polymerase.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.