POLD4 Antibody - #DF9448
Product: | POLD4 Antibody |
Catalog: | DF9448 |
Description: | Rabbit polyclonal antibody to POLD4 |
Application: | WB IHC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 12 kDa; 12kD(Calculated). |
Uniprot: | Q9HCU8 |
RRID: | AB_2842644 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9448, RRID:AB_2842644.
Fold/Unfold
DNA polymerase delta smallest subunit p12; DNA polymerase subunit delta 4; DNA polymerase subunit delta p12; p12; POLD 4; POLDS; Polymerase (DNA directed) delta 4;
Immunogens
A synthesized peptide derived from human POLD4, corresponding to a region within the internal amino acids.
- Q9HCU8 DPOD4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
As a component of the tetrameric DNA polymerase delta complex (Pol-delta4), plays a role in high fidelity genome replication and repair. Within this complex, increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity. Pol-delta4 participates in Okazaki fragment processing, through both the short flap pathway, as well as a nick translation system. Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb. Involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites. Its degradation in response to DNA damage is required for the inhibition of fork progression and cell survival.
Ubiquitinated; undergoes 'Lys-48'-linked ubiquitination in response to UV irradiation, leading to proteasomal degradation. This modification is partly mediated by RNF8 and by the DCX(DTL) E3 ubiquitin ligase complex (also called CRL4(CDT2)). Efficient degradation requires the presence of PCNA and is required for the inhibition of fork progression after DNA damage.
Nucleus.
Note: Partially recruited to DNA damage sites within 2 hours following UV irradiation, before degradation.
Belongs to the DNA polymerase delta subunit 4 family.
Research Fields
· Genetic Information Processing > Replication and repair > DNA replication.
· Genetic Information Processing > Replication and repair > Base excision repair.
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
· Genetic Information Processing > Replication and repair > Mismatch repair.
· Genetic Information Processing > Replication and repair > Homologous recombination.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.