DHRS9 Antibody - #DF9438
| Product: | DHRS9 Antibody |
| Catalog: | DF9438 |
| Description: | Rabbit polyclonal antibody to DHRS9 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 35 kDa; 35kD(Calculated). |
| Uniprot: | Q9BPW9 |
| RRID: | AB_2842634 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9438, RRID:AB_2842634.
Fold/Unfold
3 alpha hydroxysteroid dehydrogenase; 3-@alpha-HSD; 3-@alpha-hydroxysteroid dehydrogenase; 3-alpha hydroxysteroid dehydrogenase; 3-alpha-HSD; 3alpha HSD; Dehydrogenase/reductase SDR family member 9; DHRS9; DHRS9_HUMAN; NADP dependent retinol dehydrogenase/reductase; NADP-dependent retinol dehydrogenase/reductase; RDH-E2; Rdh15; RDHE2; RDHL; RDHTBE; retinol dehydrogenase homolog; Retinol dehydrogenase, tracheobronchiol epithelail cell-specific; RETSDR8; SDR family, member 9; SDR9C4; short chain dehydrogenase/reductase family 9; short chain dehydrogenase/reductase family 9C, member 4; Short chain dehydrogenase/reductase retSDR8; Short-chain dehydrogenase/reductase retSDR8;
Immunogens
Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.
- Q9BPW9 DHRS9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. Plays also a role in the biosynthesis of retinoic acid from retinaldehyde. Can utilize both NADH and NADPH.
Microsome membrane. Endoplasmic reticulum membrane.
Note: Associated with microsomal membranes.
Highly expressed in trachea and epidermis. Detected at lower levels in spinal cord, bone marrow, brain, tongue, esophagus, heart, colon, testis, placenta, lung, skeletal muscle and lymph node.
Homotetramer.
Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Research Fields
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.