CLDN23 Antibody - #DF9395
| Product: | CLDN23 Antibody |
| Catalog: | DF9395 |
| Description: | Rabbit polyclonal antibody to CLDN23 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Rabbit |
| Mol.Wt.: | 32 kDa; 32kD(Calculated). |
| Uniprot: | Q96B33 |
| RRID: | AB_2842591 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9395, RRID:AB_2842591.
Fold/Unfold
2310014B08Rik; Claudin23; CLDN 23; CLDN23; CLDNL;
Immunogens
Expressed in germinal center B-cells, placenta, stomach as well as in colon tumor.
- Q96B33 CLD23_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96B33 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S203 | Phosphorylation | Uniprot | |
| S204 | Phosphorylation | Uniprot | |
| T207 | Phosphorylation | Uniprot | |
| Y223 | Phosphorylation | Uniprot | |
| Y224 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.
Expressed in germinal center B-cells, placenta, stomach as well as in colon tumor.
Belongs to the claudin family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs). (View pathway)
· Human Diseases > Infectious diseases: Viral > Hepatitis C.
· Organismal Systems > Immune system > Leukocyte transendothelial migration. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.