CMTM5 Antibody - #DF9387
Product: | CMTM5 Antibody |
Catalog: | DF9387 |
Description: | Rabbit polyclonal antibody to CMTM5 |
Application: | WB |
Reactivity: | Human, Rat |
Mol.Wt.: | 25 kDa; 25kD(Calculated). |
Uniprot: | Q96DZ9 |
RRID: | AB_2842583 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9387, RRID:AB_2842583.
Fold/Unfold
1500005P16Rik; 2900052H21Rik; Chemokine like factor super family 5; Chemokine like factor super family five variant 4; Chemokine like factor superfamily 5; Chemokine-like factor superfamily member 5; CKLF-like MARVEL transmembrane domain containing 5; CKLF-like MARVEL transmembrane domain-containing protein 5; CKLF5_HUMAN; CKLFSF5; CMTM5; FLJ37521;
Immunogens
- Q96DZ9 CKLF5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Research Backgrounds
Membrane>Multi-pass membrane protein.
Highly expressed in the brain.
Belongs to the chemokine-like factor family.
References
Application: IHC Species: Human Sample: breast cancer and paracancerous tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.