CEP27 Antibody - #DF9361
| Product: | CEP27 Antibody |
| Catalog: | DF9361 |
| Description: | Rabbit polyclonal antibody to CEP27 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Sheep |
| Mol.Wt.: | 27 kDa; 27kD(Calculated). |
| Uniprot: | Q9NVX0 |
| RRID: | AB_2842557 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9361, RRID:AB_2842557.
Fold/Unfold
C15orf25; Centrosomal protein 27 kDa; Centrosomal protein of 27 kDa; CEP27; Chromosome 15 open reading frame 25; FLJ10460; HAUS augmin-like complex subunit 2; Haus2; HAUS2_HUMAN; HsT17025;
Immunogens
- Q9NVX0 HAUS2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NVX0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S37 | Phosphorylation | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| K63 | Ubiquitination | Uniprot | |
| K71 | Ubiquitination | Uniprot | |
| K74 | Ubiquitination | Uniprot | |
| K88 | Ubiquitination | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| K115 | Ubiquitination | Uniprot | |
| K192 | Ubiquitination | Uniprot | |
| K203 | Ubiquitination | Uniprot | |
| Y210 | Phosphorylation | Uniprot | |
| K213 | Ubiquitination | Uniprot | |
| K226 | Ubiquitination | Uniprot |
Research Backgrounds
Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Localizes to interphase centrosomes and to mitotic spindle microtubules.
Component of the HAUS augmin-like complex. The complex interacts with the gamma-tubulin ring complex and this interaction is required for spindle assembly.
Belongs to the HAUS2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.